KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0556Help
Entry
SHJGH_0556        CDS       T02531                                 

Definition
(GenBank) putative abasic site repairing enzyme
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AGF60222
LinkDB All DBs
Position
complement(669649..670530)
Genome map
AA seq 293 aa AA seqDB search
MNALRFGYGTNGLADLRLDDALALLADLGYDGVGLTLDHMHLDPLAPGLADRTRRVARRL
AGLGLDVAVETGARYVLDPRRKHGPSLLDPDPGARARRVDLLLRAVRVAADLGATAVHCF
SGIVPPTDPGPAPAWERLAASLSPVLDAAASAGLPLAVEPEPGHLLASLADFHHLRRLLG
DPPALGLTLDIGHCQCLEPLPPADCVRAAAPWLRHVQIEDMRRGVHDHLPFGEGEIDFPP
VLAALAATGYRGLTVVELPRHSHAGPQHAATSLPFLRRATARTPATVHEGSTP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccctgcgcttcggctacggcaccaacggtctcgccgatctccggctggacgac
gccctcgccctgctcgccgacctcgggtacgacggtgtcgggctgaccctcgaccacatg
cacctcgacccgctggcccccggcctcgccgaccgtacccggcgggtggcccggcgcctg
gccgggctggggctcgacgtggccgtggagaccggcgcccggtacgtcctcgatccgcgc
cgcaaacacggtccctcgctgctcgaccccgaccccggggcccgcgcccggcgcgtggac
ctgctgctgcgggcggtgcgagtggccgccgacctcggtgccacggccgtgcactgcttc
agcggaatcgttccgccgaccgatcccggcccggcgccggcgtgggagcggctcgccgcc
tccctctcccccgtcctcgacgcagccgcgtccgccggtcttcccctcgccgtcgaaccg
gagccgggccacctcctcgcgagcctcgccgacttccaccatctgcgccgcctcctcggc
gatccgcccgcgctcggcctcaccctcgacatcggccactgccagtgcctggagccgctg
ccgcccgccgactgcgtacgcgccgccgcgccctggctacggcacgtgcagatcgaggac
atgcggcggggcgtgcacgaccacctcccgttcggcgagggcgagatcgacttcccgccc
gtcctcgcggccctcgccgccaccggctaccggggcctgacggtcgtggagctgccccgc
cactcccacgccggcccccagcatgccgccacctccctgccgttcctccgccgcgcgact
gcccgcaccccggccaccgtgcacgaagggagcaccccgtga

DBGET integrated database retrieval system