KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_0683Help
Entry
SHJGH_0683        CDS       T02531                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGF60349
LinkDB All DBs
Position
804001..805440
Genome map
AA seq 479 aa AA seqDB search
MITYDKLYIGGRWTEPAKKDLLEVRSPHDRSLVGLAAEATKPDVDLAVDAARKAFDEGPW
PRLSPAERQNVIARFNDLYAKRTEEIADLTTAENGSARWFTGWTAAALPQQTDAFLRAAA
VLPWEEELPRTDGAPGRILVRREPVGVVAAVIPWNAPHQSALVKIVPALLAGCTVVLKTS
PENALVTLLLGEILTAAGVPEGVVSILPADRATSEYLISHPGIDKIAFTGSTGAGRTIAA
IAGRQLKRVSLELGGKSAAIVLEDADLDAMAEGLKFHSFANNAEACVAHTRILVHRSRYD
EAVARLKDLVESLTVGDPSDPATFIGPMVRADQQERVRSYIETGIREGARLVTGGPEVPA
GLEDGYYVTPTLFADVDNSMRIAQEEIFGPVLVVIPFDDDDHAVRIANDSPYGLGGGVWT
ADEDRALEIARRIRTGTFSVNGAPFSFDAPFGGFKSSGIGREFGAAGLTQYVEYKTVAV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgatcacttacgacaagctgtacatcggcggacgctggaccgagcccgccaagaaggac
ctgctggaggtccgctccccgcacgaccggtccctggtcgggctggccgccgaggccacg
aagcccgatgtggacctcgccgtcgacgccgcccgcaaggccttcgacgaaggcccctgg
ccgcgcctgtccccggccgaacgccagaacgtcatcgcccgcttcaacgacctctacgcc
aagcgcaccgaggagatcgcggacctcaccaccgccgagaacggcagcgcgcgctggttc
accggctggaccgccgccgccctgccccagcagaccgacgccttcctgcgtgccgcggcc
gtcctgccgtgggaggaggaactgccgcggaccgacggtgccccgggccgcatcctggta
cgccgcgaaccggtcggtgtcgtagcggccgtcatcccctggaacgccccgcaccagtcc
gcgctcgtcaagatcgtccccgctctcctggcgggctgcaccgtcgtgctcaagacatcg
cccgagaacgccctcgtcacgctgctgctgggggagatcctcaccgcagcgggcgtgccg
gagggcgtggtcagcatcctgccggccgaccgcgccaccagcgagtacctcatctcccac
cccggtatcgacaagatcgcgttcaccggttcgacgggcgccggacgcaccatcgcggcc
atcgccggccggcagctcaagcgggtgagcctggagctcggcggcaagtccgccgccatc
gtgctggaggacgccgacctcgacgccatggcggagggcctgaagttccactccttcgcc
aacaacgccgaagcctgcgtcgcgcacacgcggatcctcgtgcaccgcagccgctacgac
gaggccgtggccaggctgaaggacctcgtcgagtcgctgaccgtcggcgatccctccgac
cccgcgaccttcatcgggccgatggtcagggcggaccagcaggagcgcgtgcggtcgtac
atcgagacgggaatccgcgagggcgcccggctcgtcaccggcggccccgaggtccccgcc
ggtctggaggacggctactacgtcacccccaccctcttcgccgacgtcgacaactccatg
cgcatcgcccaggaggagatcttcggtcccgtgctcgtggtcatccccttcgacgacgac
gaccacgcggtccgcatcgccaacgattccccgtacggcctcggcggcggcgtgtggacg
gccgacgaggaccgcgccctggagatcgcccggcgcatccgcaccggcaccttctccgtc
aacggcgcgccgttctccttcgacgcccccttcggagggttcaagagcagcggcatcggc
agggagttcggcgcggccggcctgacccagtacgtcgagtacaagacggtcgcggtctga

DBGET integrated database retrieval system