KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_1672Help
Entry
SHJGH_1672        CDS       T02531                                 

Definition
(GenBank) modular polyketide synthase
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thiolase_N PikAIV_N Epimerase ACP_syn_III GDP_Man_Dehyd Polysacc_synt_2 NmrA SAT
Motif
Other DBs
NCBI-ProteinID: AGF61338
LinkDB All DBs
Position
complement(2007162..2017679)
Genome map
AA seq 3505 aa AA seqDB search
MDTSVEQIVEALRESLLDNERLRQQNAQLTEAAQEPVAIVAMSCRYPGGVTTPEQLWELV
DTGTDAVGDFPADRGWDTEGIYDPDPDAPGKTHVREGGFLYDAPRFDPGFFGISPREAIA
MDPQQRLLLETSWEAFERAGIDPHTLKGSRTGVYAGVMYHDYGSWLTEVPEGVEGYLGNG
NLGSVASGRVSYTLGLEGPAVTVDTACSSSLVALHLAVRALRTGECDLALAGGVTVMSTP
DTFIDFSRQRGLALDGRCKSFAEGADGTGWGEGAGLLLLERLGDARRHGHRVLAVVRGTA
VNQDGASNGLTAPNGPSQQRVIRAALADARLEPRQVHAVEAHGTGTPLGDPIEAQALLAT
YGQDRAEPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGRLPRTLHAEQPTSRVDWEEG
AVELLKDARDWPADGEPRRAAVSSFGISGTNAHVIIEAAPEPEPRAQEPSWTGPLPLVLS
GHGEQGLAAQARGLLDHLTTGTDPVPDIAHTLATGRAALTERAVVTGADLPALTAGLTAL
AEGGTAPNVVRGRPATESRIAFVFPGQGSQWAGMAADLLDTSPEFAARMADCAAALAPVT
DWDLIETVRARQPLERVDVVQPVLWAIMVSLAEVWRAHGVRPAAVIGHSQGEIAAACVAG
ALSLADGARVVALRSQAIARELSGRGGMMSVALPEARVRELMGRYDGRVAVAAVNGASSV
VLSGDADALDELRETIVAGGDRAKRLPVDYASHCAHVESIRERLLADLAGIQARPAEVPF
YSTVTGARLDTTRLDAGYWYTNLRQSVLFEPTTRTLLDAGYGVFVECSPHPVLLHSIEET
ADAAGADVTGLGSLRRDDGGPERVLTALGEAFVAGVPVDWSAVFSGMPVRAADLPTYAFQ
RERYWLGRSAATGDVTAAGLDTTGHPLLGAAVPVAEGGTLFTGRLSTATAPWLADHAVSG
TTLLPGTALVELALGAGHDLGCGHLAELTLQAPLPLPERGAVQLQLHVAAADDGGHRALT
VHSRPEGADGTAWTLHATGLLAPRAAPPSFDLTAWPPQGARPVPVEDAYDRLAGLGYDYG
PAFQGLRAVWRRGDETFAEVELPVEREGFALHPALFDAALHADGLAADGSPADGEATARL
PFAWTGVSLHAAGATALRVRLHGGETLSVQLADPTGAPVAEVEALVSRPVDPAALTPAAR
PDDLYRLDWPALPVPEAPAPGFAVLDEQGPAALDTVPAWVVLPAGDADPLTGARRATERV
LTAVQDWLADERTASARLLVLTRGAVAVGEEDVTDLAGAAVWGLVRAAQGEHPGRFVLVD
GADADAAVAVAAATAEPQLALRDGTVHVPRLARATPAGPPPALDPDGTVLITGGTGVLGA
LVARHLVAAHGVRRLVLAGRSGTAADDFADLDAEIVVARCDAADRGQLAGLLADVPAEHP
LTAVVHLAGVLDDGLVTDQTPERLDAVLRPKADAAWHLHELTRDLGLAAFVLFSSAAGTV
DGAGQSGYAAANAFLDALAAHRRHHGLPAHSLAWGFWEQRTGLTAHLTDADVARMARAGV
RPLATEEGLRLLDAALGTAEPLLLPVGLDLAVLRRAGDVPAVLRALVPVRARRTAASRAD
AGSLADRLAALGPAERDAALTELVRTHVAAVLGHGGDMALDPRRSFRELGFDSLTAVELR
NRLGTAVGLRLPATLVFDYPDAGALVGFLRSELFGDQAEAATEAAAREPDEPVAIVAMAC
RYPGGVSTPEELWRLLADGGDGIGAFPTDRGWDLDGLYDPEPGKAGHSSTRAGGFLYDAA
DFDPDFFGIGPREALAMDPQQRLLLETSWEALERAGIDPHSVRGSRTGVFAGVMYHDYGS
RLRHVPESVRDYLGNGSLGSVASGRVAYALGLEGPTLTVDTACSSSLVALHLAAQALRQG
ECTLALAGGVSVMSTVDTFVDFSRQRNLAADGHAKSFADAADGTALSEGAGMLVLERLSD
ARRNGHPVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASARLSAADVDVVEAHGT
GTTLGDPIEAQALLATYGQDRTEPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHEVLPR
TLHVDQPSTKVDWDAGQVRLLTEEQPWPRTDRPRRAGVSSFGISGTNVHTIIEEAPAGEP
APDTDTDTDAAPAPLLPLVLSGATPEALAAQAARLSAVADRPLPDLARSLATGRAALTHR
AAVVARDRDELLAGLAALTDGTASDTVVRGRPADGKAAVLFTGQGAQRPGMGRALYAAHP
AFRQALDEVCQALDAHLDRPLRDVMWAEPGTEDAGLLDHTLYTQSALFAVETALYRLLES
CGVRPDWLAGHSIGELTAAHVAGVWDLADAARLVAARGRLMQALPAGGAMLAVDATEEEV
LEHLGPEVSVAAVNGPRAVVVSGSEAAVAAVAEAFPGRRTKRLRVSHAFHSPLMDPMLAE
FEKTARELRYAPPAIPVVSDVTGVRAGEDELCAPEYWVRHVREAVRFGDAVRTLEADGVR
TFLELGPDAVLSAMGAQAVADAERSAFVPALRRDRDEERTFATLLGTAHARGMTVDWQRV
FAGTGARRTDLPTYAFQRRRLWLDDEPGAVTDAGGLGQAPAGHPMLGAALELAGDDRVAL
TGRLSLATHPWLADHAVAGVVLVPGSAFVELAVRAGDRTHCPRVEELTLERPLVLPERGA
VHLQVAVAAPDADGRRRLTVHARPEGADGEWTRHATGALAPHTAPEPAPVTDWPPAGAVP
VDVTGTYDHLAEQGYHYGPSFRCLRGAWRLGEEVWAELALPDAEAADGFGLHPALLDSTL
HAIDLLDGQDPTVMTLPFSWEGVTLYATGATAVRLRLTPHGTDHMTLRLYDGAGAPVAEV
TALRVRQVTTEQLNAATPAPGDLFRVRWTELPLTRTDSAPEPRTLTVPTEGDPGDDLPAL
ARRTAVRALAALRRDLVDVPDGAPLVVVTRSAVAVHADAVPDPAQAVLWGMVRAAAVEHP
GRFVLVDTDDDPASAAVLPAAVATGAPELALRAGTVYVPELAKATDAEPGPAPALDPDGT
VLVTGGTGSLGRLLARHLVTRHGVRHLLLTGRGGRLPEPGALDDLAALGAKVTVAACDAT
DRDALAALLASVPAEHPLTAVVHAAGVLDDGLLTDLTPERLEAVMRPKTDAAWHLHELTR
DLGLAAFVLFSSAAGTLGAAGQANYAAGNAFLDALAARRRTEGLPALSLGWGLWDTGEGM
AAGLGETELRRLARDGILPLPADRALDLWDAALTEAGATAADRALLLPVRVQVTADAPAL
VRGLAPAAVRRTARAAATEAPAAVEPLPRRLARLSAADAVRLLVETVCGHVADVLGHGSG
SAVDPQRSLGDLGVDSLAALDLRNRLGAETGLRLSTTLTFDYPTCDALARHLFEELGGDT
SGDAVDIEAEVVRLEELLGTALDSAALDEEQRARVAARLRTLSARWDGTGEWRESGTGPT
GDTGLETATADELFDILDGELGSFS
NT seq 10518 nt NT seq  +upstreamnt  +downstreamnt
gtggacacatccgtcgagcagatcgtcgaggcgctgcgcgagtcattgctcgataacgag
cggctgcgccagcagaacgcccagctcaccgaggcggcgcaggagcccgtcgcgatcgtc
gccatgagctgccgctaccccggcggcgtcaccacccccgagcagctgtgggagctggtc
gacaccggcacggacgccgtcggcgacttccccgcggaccgcggctgggacaccgagggc
atctacgaccccgaccccgacgcccccggcaagacccatgtccgtgagggcggcttcctg
tacgacgcgccgcggttcgaccccggcttcttcggcatcagcccccgcgaggccatcgcc
atggacccgcagcagcggctgctgctggaaacgtcctgggaggccttcgaacgcgccggc
atcgacccgcacaccctcaagggcagccgcaccggcgtctacgccggcgtcatgtaccac
gactacggcagctggctcaccgaggtgccggagggcgtcgagggctacctcggcaacggc
aacctgggcagcgtcgcctccggccgcgtctcctacaccctcggcctggaagggcccgcc
gtcaccgtcgacaccgcctgctcctcctcgctcgtcgccctccacctcgcggtgcgggca
ctgcgcaccggcgagtgcgacctcgccctcgcgggcggcgtcacggtcatgtccaccccg
gacaccttcatcgacttctcccgccagcgcggcctcgcactggacggccgctgcaagtcc
ttcgcggagggcgcggacggcaccggctggggcgagggcgccggcctgctcctgctggaa
cggctcggcgacgcccgccgccacggccaccgcgtgctggccgtggtccgcggcaccgcc
gtcaaccaggacggcgcctccaacggcctcaccgcccccaacggcccctcgcagcagcgg
gtcatccgcgccgctctcgccgacgcccgcctcgaaccccgccaggtgcacgccgtcgag
gcccacggcaccggcaccccgctcggcgacccgatcgaggcccaggcgctgctggccacc
tacggccaggaccgggccgagccgctgtggctggggtcggtcaagtccaacatcgggcac
acccaggccgccgccggtgtcgccggggtcatcaagatggtgatggccatgcggcacggc
cggctgcccaggaccctgcacgccgaacagccgacctcccgggtcgactgggaggagggc
gccgtcgaactgctgaaggacgcccgcgactggcccgccgacggcgagccccgccgcgcc
gccgtctcctccttcggcatcagcggcaccaacgcccacgtcatcatcgaggccgccccg
gagcccgagccccgcgcacaggagccctcctggaccggaccgctcccgctggtgctgtcc
ggccacggcgaacagggcctcgccgcccaggcccgcggcctgctggaccacctcaccacc
ggcaccgaccccgtccccgacatcgcccacaccctcgccaccggacgcgccgcgctcacc
gaacgggccgtcgtcaccggcgccgacctgcccgccctcaccgcgggcctgaccgccctc
gccgagggcggcaccgcgccgaacgtggtgcgcggcaggcccgcgaccgagtcccggatc
gccttcgtcttccccggacagggctcccagtgggccgggatggccgccgacctgctcgac
acctcacccgagttcgccgcgcgcatggccgactgcgccgccgccctcgcccccgtcacc
gactgggacctcatcgagaccgtacgggcgcggcagccgctggagcgggtggacgtcgtc
cagcccgtgctgtgggcgatcatggtgtcgctcgccgaggtgtggcgcgcccacggggtc
cggcccgccgccgtcatcggccactcccagggcgagatcgccgccgcctgcgtggccggc
gcgctctccctcgccgacggcgcccgcgtcgtcgccctgcgcagccaggccatcgcccgc
gaactctccggccgcggcggcatgatgtcggtggcgctgcccgaggcccgggtgcgcgag
ctcatgggccgctacgacggccgggtcgcggtggccgccgtcaacggcgcctcctccgtg
gtgctgtccggcgacgccgacgccctggacgagctccgcgagaccatcgtggccggcggc
gaccgcgccaagcggctccccgtggactacgcctcgcactgcgcgcacgtcgagtcgatc
cgggagcggctgctcgccgacctggcgggcattcaggcccggcccgccgaggtgccgttc
tactccaccgtcaccggcgcgcggctggacaccacccgcctggacgccggttactggtac
accaacctgcgccagagcgtgctgttcgagcccaccacccgcaccctgctcgacgccggg
tacggggtgttcgtggagtgcagcccgcaccccgtactgctgcacagcatcgaggagacc
gccgacgccgcgggcgccgacgtcaccggcctcggctcgctgcgccgcgacgacggcggc
cccgagcgcgtcctgaccgccctgggcgaggccttcgtcgcgggcgtcccggtcgactgg
tcggccgtgttcagcggcatgccggtacgcgccgccgaccttcccacctacgccttccag
cgcgagcggtactggctgggccggtccgccgccaccggtgacgtcaccgccgccggcctg
gacaccaccggccacccgctgctgggcgccgccgtcccggtcgccgagggcggcaccctg
ttcaccggccggctctccaccgccaccgccccctggctggccgaccacgccgtgtccggc
accaccctgctgcccggcaccgccctggtcgagctggcgctcggcgcgggccacgacctc
ggctgcgggcacctcgccgaactgaccctccaggcaccgctgccgctgcccgagcggggc
gcggtccagctccagctgcacgtggccgccgccgacgacggcggacaccgcgcgctgacc
gtccactcccgccccgagggcgccgacggcacggcctggaccctgcacgccaccggcctg
ctcgccccgcgagccgccccgccgtccttcgacctgacggcctggccgccccagggcgcc
cggcccgtaccggtcgaggacgcctacgaccgcctggccggcctcggctacgactacggg
cccgccttccaggggctgcgcgcggtctggcggcgcggcgacgagaccttcgccgaggtc
gaactgccggtcgagcgtgagggcttcgccctgcacccggcgctgttcgacgccgccctg
cacgccgacggcctcgccgcggacggttcccccgccgacggtgaggccaccgccaggctg
cccttcgcctggaccggggtctcgctgcacgcggccggggccaccgccctgcgggtccgg
ctgcacggcggcgagacgctctccgtccagctggccgaccccacgggcgccccggtcgcc
gaggtcgaggccctcgtctcccggcccgtcgacccggccgccctcaccccggccgcccgc
ccggacgacctgtaccgcctggactggccggccctgcccgtgcccgaggcgcccgcgccc
ggcttcgccgtcctggacgaacagggcccggccgcgctggacaccgtgcccgcgtgggtg
gtgctgcccgccggcgacgccgacccgctcaccggggcgcgccgggcgaccgagcgggtg
ctgaccgccgtacaggactggctggccgacgaacgcaccgcctccgcacggctgctggtg
ctcacgcgcggcgccgtcgcggtgggggaggaggacgtcaccgatctggcgggggccgcc
gtgtggggcctggtccgggccgcgcagggcgagcacccgggccggttcgtgctcgtggac
ggcgcggacgccgacgccgccgtggccgtcgcggcggccaccgcggaaccccaactcgcc
ctgcgcgacggcaccgtccacgtgccccggctcgcccgcgccaccccggcaggaccgccg
cccgccctcgacccggacggcaccgtgctgatcaccggcggcaccggcgtgctcggcgcc
ctggtcgcccgtcacctggtcgccgcgcacggcgtgcgccgcctggtgctggccgggcgc
agcggcaccgccgccgacgacttcgccgacctggacgcggagatcgtcgtggcccgctgc
gacgccgccgaccgcggccaactggccggcctcctcgccgacgtaccggccgagcacccg
ctgaccgccgtcgtccacctcgccggcgtcctcgacgacggactggtcaccgaccagaca
cccgaacgcctggatgccgtactgcgtcccaaggccgacgccgcctggcacctgcacgag
ctgacccgcgacctcggcctcgccgcgttcgtcctgttctcctccgccgccggcacggtc
gacggcgccggacagtccggctacgccgccgccaacgccttcctcgacgcgctggccgcc
caccgcaggcaccacggcctgcccgcgcactcgctggcctggggcttctgggagcagcgc
accggactgaccgcccacctcaccgacgccgacgtggcccgcatggcccgcgcgggcgtc
cgccccctcgccaccgaggagggcctgcggctgctcgacgccgccctgggcaccgccgag
ccgctgctgctcccggtcggcctggacctggccgtcctgcgccgcgccggcgacgtcccg
gccgtgctgcgcgctctggtgcccgtgcgcgcccgccgtaccgcggcctcccgcgcggac
gccggatcgctcgccgaccggctggccgccctcggccccgccgaacgcgacgcggccctc
acggaactcgtccgcacccatgtcgccgccgtcctcggccacggcggtgacatggcgctc
gacccgcgccgctccttccgcgaactgggcttcgactcgctgaccgccgtggaactgcgc
aaccgactcggcaccgcggtcggcctgcgcctgcccgccaccctcgtcttcgactacccc
gacgcgggcgccctcgtgggattcctgcggagcgaactcttcggggaccaggccgaggcc
gccaccgaggccgccgcgcgggaacccgacgagccggtcgccatcgtcgccatggcctgc
cgctaccccggcggcgtcagcacacccgaggagctgtggcggctgctcgccgacggcggt
gacggcatcggtgccttccccaccgaccgcggctgggacctggacggcctgtacgacccg
gagccgggcaaggccggccactcctccacccgggcgggcggattcctgtacgacgccgcc
gacttcgaccccgacttcttcggcatcggcccgcgcgaggccctcgccatggacccgcag
cagcggctgctcctggagacctcctgggaggcgctggaacgggccggcatcgacccgcac
tccgtgcgcggcagccgcaccggcgtcttcgccggcgtcatgtaccacgactacggcagc
cggctgcggcacgtccccgagtccgtccgcgactacctcggcaacggcagcctcggcagc
gtggcctccggccgggtcgcctacgccctcggtctggagggcccgacgctcaccgtcgac
acggcctgctcgtcgtccctggtggccctgcacctggccgcgcaggcgctgcgccagggc
gagtgcaccctggccctggccgggggtgtgtccgtgatgtcgaccgtcgacaccttcgtg
gacttcagcaggcagcgcaacctcgccgccgacggccacgccaagtccttcgccgacgcc
gccgacggcacggccctgtccgagggcgccggcatgctcgtcctggagcggctgtcggac
gcgcggcgcaacgggcatccggtgctggcggtggtgcggggttcggccgtgaaccaggac
ggggcctccaatggtctgacggcgccgaacggtccgtcgcagcagcgggtgatccggcag
gcgttggcgtcggcccggttgtcggcggcggacgtggacgtggtggaggcgcacggtacg
gggacgacgctgggtgacccgatcgaggcgcaggcgctgctggccacttacgggcaggac
cgtaccgagccgttgtggctcggctcggtcaagtcgaacatcgggcacacgcaggccgcc
gccggtgtcgcgggcgtcatcaagatggtgatggcgatgcgtcacgaggtgctgccgagg
accctgcacgtcgatcagccgtccacgaaggtcgactgggacgccggacaggtccgcctg
ctgacggaggagcagccctggccccggaccgaccgtccgcgccgggccggtgtgtcctcc
ttcggcatcagcggcaccaacgtccacaccatcatcgaggaggccccggccggggagccc
gccccggacacggacacggacacggacgcggcaccggccccgctgctgcccctcgtgctc
tccggcgcgacccccgaggccctggccgcgcaggccgcccggctgagcgcggtcgccgac
cggcccctgcccgacctcgcccgctccctggccactggccgcgctgccctcacccaccgg
gccgccgtcgtcgcccgcgaccgggacgaactcctcgccggactcgccgcgctgaccgac
ggcaccgcctcggacaccgtggtccgcggccggcccgccgacggcaaggccgccgtcctc
ttcaccggccagggcgcccagcgtcccggtatgggccgcgccctgtacgccgcccacccg
gccttccggcaggccctcgacgaggtctgccaggcgctcgacgcccacctcgaccgcccg
ctgcgggacgtgatgtgggcggagcccggcactgaggacgccggcctgctcgaccacacc
ctttacacgcagagcgccctgttcgccgtcgagaccgccctgtaccggctgctggagtcc
tgcggcgtacggcccgactggctcgccgggcactccatcggcgaactgacggcggcgcac
gtcgccggcgtctgggacctggcggacgccgcccggctggtcgccgcgcgcggccggctg
atgcaggcgctgcccgccggcggcgcgatgctcgccgtcgacgccaccgaggaggaggtg
ctggagcacctcggccccgaggtgtccgtcgccgccgtcaacgggccccgcgccgtcgtc
gtgtccggctccgaggccgccgtcgccgccgtcgccgaggcgttccccggccgccgcacc
aagcggctgcgggtcagccacgccttccactccccgctgatggacccgatgctggcggag
ttcgagaagacggcccgcgaactgcggtacgcgccgcccgcgatccccgtcgtctccgac
gtgaccggcgtacgcgccggcgaggacgaactgtgcgcgcccgagtactgggtccggcac
gtccgggaggcggtccgcttcggcgacgccgtccgcacactggaggccgacggcgtgcgc
accttcctcgaactcggtcccgacgccgtcctgtcggccatgggcgcgcaggccgtcgcc
gacgccgaacggtcggcgttcgtgcccgcgctgcgccgcgaccgcgacgaggagcggacc
ttcgcgacgctgctcggcaccgcccacgcgcgcggcatgaccgtcgactggcaacgggtc
ttcgccggtaccggggcccgccgcaccgacctgccgacctacgccttccagcggcggcgg
ctgtggctggacgacgagcccggcgcggtcaccgacgccggcgggctgggccaggcaccg
gccgggcacccgatgctcggcgccgccctggaactcgccggcgacgaccgggtggccctc
accggccggctgtccctcgccacccacccgtggctcgcggaccacgccgtggccggggtc
gtcctcgtcccgggcagcgccttcgtcgaactcgccgtgcgggccggcgaccgcacgcac
tgcccgcgcgtggaggaactcaccctggaacggccactggtcctgcccgagcggggcgcc
gtccacctccaggtggccgtcgcggcccccgacgccgacgggcgccggcggctgaccgtg
cacgcccgtccggagggcgcggacggcgagtggacccggcacgccaccggcgccctcgcc
ccgcacaccgcccccgaaccggccccggtcaccgactggccgcccgccggggccgtcccc
gtggacgtcaccggcacctacgaccacctcgccgaacagggctaccactacggcccgtcc
ttccgctgcctgcgcggcgcctggcggctcggcgaggaggtctgggccgaactcgccctg
cccgacgccgaggcggccgacggcttcggactgcaccccgcgctgctcgactccacgctg
cacgccatcgacctgctcgacggccaggacccgaccgtgatgaccctgcccttctcctgg
gagggcgtcaccctgtacgccaccggcgccacggcagtccggctgcgcctcaccccgcac
ggcaccgaccacatgaccctgcgcctgtacgacggcgcgggcgcccccgtcgccgaggtg
accgcgctgcgcgtccgccaggtcaccaccgagcagctgaacgcggccacaccggccccc
ggcgacctgttccgcgtgcgctggaccgaactcccgctcacccgcaccgactcggcaccc
gagccccgcaccctcaccgtgccgacggagggtgaccccggtgacgacctgcccgcgctg
gcccgtcggaccgccgtgcgggccctcgccgcgctgcgacgggacctcgtcgacgtgccg
gacggcgcgccgctggtggtggtgacccggtccgccgtcgccgtccacgccgacgccgtg
cccgacccggcgcaggccgtgctctggggcatggtgcgggcggcggcggtcgagcacccc
ggccggttcgtgctcgtcgacaccgacgacgacccggcctcggccgccgtcctcccggcc
gccgtcgccaccggcgcacccgaactcgccctgcgggcgggcacggtgtacgtaccggaa
ctggccaaggccacggacgcggagcccggcccggcgcccgcgctcgacccggacggcacc
gtgctggtgaccggcggcaccggcagcctcggccgactgctggcccggcacctggtcacc
cggcacggcgtacgccacctgctgctgaccggccggggcgggcggctgcccgagcccggc
gccctggacgacctggccgccctcggcgcgaaggtgaccgtcgccgcctgcgacgccacc
gaccgggacgcgctcgccgccctgctggcgtccgtgccggccgagcacccgctgaccgcc
gtggtgcacgccgccggcgtcctggacgacggactgctcaccgacctcacccccgagcgg
ctggaggcggtgatgcgcccgaagaccgacgccgcctggcatctgcacgagctgacccgt
gacctcggcctcgccgcgttcgtcctgttctcctccgccgccggcaccctgggcgcggcg
gggcaggccaactacgcggccggcaacgccttcctggacgccctcgccgcgcggcgccgc
accgagggcctgccggccctgtcgctgggctgggggctgtgggacacgggggagggcatg
gcggccggtctcggtgagacggagctgcgccggctggcccgcgacggcatcctgccactg
cccgccgaccgcgcgctggacctgtgggacgcggcgctgaccgaggcgggcgccacggcc
gccgaccgcgccctgctgctcccggtccgcgtccaggtcaccgccgacgcccccgccctg
gtacggggcctcgccccggcggccgtccgccgcaccgcccgggcggcggccaccgaggcg
ccggcagccgtcgaaccgctgccgcggcggctggcccggctgagcgccgccgacgccgtg
cggctgctggtggagacggtgtgcgggcacgtcgccgacgtcctcggacacggctccggc
agcgcggtcgatccccagcgttccctgggcgacctgggcgtggactcgctcgccgccctc
gacctgcgcaaccggctcggcgccgagaccggcctgcggctgtccaccaccctcaccttc
gactacccgacctgcgacgccctcgcccggcacctcttcgaggaactcggcggggacacg
tccggcgacgcggtcgacatcgaggccgaagtggtccgcctggaggagctgttgggcacc
gcgctggactcggccgcgctggacgaggagcagcgggcccgggtggcagcccggctgcgc
accctgagcgcgcgctgggacggcaccggcgagtggcgggagagcggcaccggtcccacc
ggggacacgggactggagacggccacggccgacgagctgttcgacatcctggacggtgaa
ctgggcagcttcagctga

DBGET integrated database retrieval system