KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_2229Help
Entry
SHJGH_2229        CDS       T02531                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SHJGH_2229
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SHJGH_2229
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SHJGH_2229
    1.1.1.-  
     SHJGH_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGF61895
LinkDB All DBs
Position
2658718..2659776
Genome map
AA seq 352 aa AA seqDB search
MKAARFYGPGDIRIDDVQEPATRPGTVKVEVEWCGICGTDLHEYLEGPIFAPAIGRPHPL
TGETVPITLGHEFAGVVRELGDGVGDLRVGDRVVVEPYVVCGRCDPCLRGMYNVCQSLGF
VGLSGGGGGFSQFVVAERRWIHPLGELGTDVGALIEPLAVAYHAVRLSGARSADTAIVFG
AGPIGLVTTAVLRAVGTESIIVVEPADVRKAKAVMAGADHILDPATTDIATAVSELTKGR
NADVTFECAGIDAVLKSAILSTRAGGTCVNVAIWGHEARVALNDLVFREVKVLGSLAYAN
DHPATISLVASGRVDPYQFITGRIGLDDIVTSGFDELVDNKEENVKILVRPH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgcttctacggtccgggcgacatccggatcgacgatgtacaggaacca
gcgacacggccgggcaccgtcaaggtcgaggtcgaatggtgcggcatttgcggcaccgac
ctccacgagtatctggaaggtcccattttcgcgccggccataggcaggccgcaccccctg
acgggcgagaccgtgcccatcactttgggtcacgagttcgcgggagtggtccgggaactc
ggtgacggtgtcggtgacctgcgcgtgggcgaccgggtcgttgtcgaaccctacgtcgtg
tgcggccggtgcgacccctgtctgcgcggcatgtacaacgtctgccagtcgctgggattc
gtcggcctctccggcggaggaggcggattctcacaattcgtcgtagccgaacgccgctgg
atccacccgctcggcgaactcggcacagacgtgggggcgctcatcgagccactcgcggtc
gcctaccacgccgtacggctgtccggcgcccggtccgccgacaccgccatcgtgttcggt
gcgggaccgatcggcctggtgaccacggctgttctgcgtgcggtcggcaccgagtcgatc
atcgtcgtggagcccgcggacgtacgcaaggccaaagcagtcatggccggcgccgaccac
atactcgatccggccactacggacatcgctacggcggtgtcggaactgaccaagggccgc
aacgccgacgtgaccttcgaatgcgccggcatcgacgcggtgctcaagtccgcgatcctt
tccacacgcgcgggcggcacctgcgtgaacgtcgccatctggggacacgaggccagggtc
gcactgaacgatctggtgttccgcgaggtcaaggtgctcggcagcctcgcatatgcgaac
gaccacccggcgaccatttccctggtcgcgagcggccgggtcgacccgtaccagttcatc
accggccggatcggtctggacgacatcgtcacgagcggcttcgacgaactggtggacaac
aaggaggagaacgtcaagatcctggtccgcccgcactga

DBGET integrated database retrieval system