KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_3518Help
Entry
SHJGH_3518        CDS       T02531                                 

Definition
(GenBank) neuramidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00511  Other glycan degradation
sho00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SHJGH_3518
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SHJGH_3518
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sho02042]
    SHJGH_3518
Enzymes [BR:sho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SHJGH_3518
Bacterial toxins [BR:sho02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SHJGH_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-ProteinID: AGF63183
LinkDB All DBs
Position
complement(4044154..4045227)
Genome map
AA seq 357 aa AA seqDB search
MTDVTVPFRAGHEGYASFRIPAVVASRSGTLLAFCEGRVDSAADHGHIDIVLKRSTDGGR
TWGPLQVAADNGANLAGNPAPVVLDTGRVLLVHVRAAATATEAAILRGQVGEADGRRVWV
QHSDDDGVTWSRPREITKQVKKPGWRWYATTPGHALQLTSGRVLVPANHTLPPTGTDTGA
EARYNSGHCLLSDDRGESWYLGYLDENTDGYVNVNETTAAELPDGRVYLNTRNDSPSPGN
RADAHSKDGGKTLVKPFRPQAGLTAPVCQGSVLQLRDPDLLLFSAPADPAARALMTIRAS
DDGGTTWRPAFTVDGLPAAYSDLVRVDPHTVGLLYETGDFGAYATITFRRVPVHRLT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtgaccgtccccttccgcgcgggccatgagggatacgcgagcttccgcata
ccggccgtcgtcgcctccaggtccggcaccctgctcgccttctgcgagggccgcgtcgac
tccgccgccgaccacgggcacatcgacatcgtgctcaagcggtccacggacggcggccgt
acctggggcccgctccaggtcgccgcggacaacggcgcgaacctcgccggcaaccccgcc
cccgtcgtcctggacaccggccgtgtcctgctcgtgcacgtgcgcgccgccgccaccgcc
accgaggcagccatcctgcgcggccaggtcggggaggccgacgggcggcgcgtgtgggtc
cagcacagcgacgacgacggggtgacctggtccaggcccagggagatcaccaagcaggtg
aagaagcccggctggcgctggtacgccaccacccccggccacgccctccagctgacgtcc
ggccgcgtcctcgtcccggccaaccacaccctgccgcccaccggcaccgacaccggcgcc
gaggccaggtacaacagcgggcactgcctgctcagcgacgaccgcggcgagagctggtac
ctgggctacctggacgagaacactgacggctacgtcaacgtcaacgagaccaccgccgcc
gaactccccgacggccgcgtctacctcaacacccgcaacgactccccgtcacccggcaac
cgcgccgacgcccactccaaggacggcggcaagaccctcgtcaagcccttccgcccgcag
gccgggctgaccgcgccggtctgccagggctccgtgctccagctccgcgaccccgacctg
ctgctcttctccgcccccgccgaccccgccgcccgcgccctgatgacgatccgcgcctcc
gacgacggcggcaccacctggcgcccggcgttcaccgtcgacgggctgcccgccgcctac
tccgacctggtccgcgtcgacccgcacaccgtcgggctactgtacgagacgggcgacttc
ggcgcctacgcgacgatcaccttccgccgggtgcccgtacaccggctgacctga

DBGET integrated database retrieval system