KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_4879Help
Entry
SHJGH_4879        CDS       T02531                                 

Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
sho01130  Biosynthesis of antibiotics
sho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SHJGH_4879
Enzymes [BR:sho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     SHJGH_4879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT SBP_bac_3 PBP_like
Motif
Other DBs
NCBI-ProteinID: AGF64542
LinkDB All DBs
Position
5554811..5555743
Genome map
AA seq 310 aa AA seqDB search
MPASYAYLGPEGTFTEVALRTLPEAATRELIPYVSVQSALDAVRAGEAEAAFVPIENSVE
GGITTTLDELVAGEPLMIYREVLLSITFALLVRPGTRLTDIKTVSAHPAAQPQVRNWLRA
NLPEATWESAASNADAARLVQEGRYDAAFAGEFTAARYGLEALETGLHDAENAQTRFVLV
GRPARPAAPSGADKTSVVLWQRDDHPGALRDLLGEFASRGINLMLLQSRPTGAGIGNYCF
CIDAEGHIADRRVAEALMGLRRICLQVRFLGSYPRADIAPGGARPTLPGTSDEEFMAAAD
WVARCQDGRF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgagctatgcctacctcggcccggagggcaccttcacggaggtcgccctgcgc
acgcttccggaggcggccacccgggagctgatcccgtacgtctcggtgcagtccgcgctg
gacgcggtccgggccggcgaggccgaggccgcgttcgtgccgatcgagaactccgtcgag
ggcggcatcaccaccaccctggacgagttggtcgcgggcgagcccctgatgatctaccgc
gaggtgctgctgtcgatcaccttcgcgctgctggtccgccccggcacccggctcacggac
atcaagacggtctccgcgcacccggcggcccagccccaggtgcgcaactggctgcgcgcc
aacctcccggaggccacctgggagtcggcggcctccaacgcggacgccgcccgcctggtc
caggagggccgctacgacgccgctttcgccggcgagttcacggccgcccggtacggcctg
gaagcgctggagaccgggctccacgacgcggagaacgcgcagacccggttcgtgctggtc
ggccgcccggcccggcccgccgcgcccagcggcgccgacaagacctccgtggtgctgtgg
cagcgggacgaccaccccggtgccctgcgcgacctgctcggcgagttcgcctcgcgcggc
atcaacctcatgctgctccagtcccggccgaccggcgccggcatcggcaactactgcttc
tgcatcgacgccgagggacacatcgccgaccggcgggtggcggaggcgttgatggggctg
cggcggatctgcctccaggtgcgcttcctcggctcctatccgcgcgcggacatcgcgccg
ggcggggcccggccgacgctgccggggacgtcggacgaggagttcatggcggcggcggac
tgggtggcgcgctgccaggacggccggttctag

DBGET integrated database retrieval system