KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5282Help
Entry
SHJGH_5282        CDS       T02531                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00010  Glycolysis / Gluconeogenesis
sho00053  Ascorbate and aldarate metabolism
sho00071  Fatty acid degradation
sho00280  Valine, leucine and isoleucine degradation
sho00310  Lysine degradation
sho00330  Arginine and proline metabolism
sho00340  Histidine metabolism
sho00380  Tryptophan metabolism
sho00410  beta-Alanine metabolism
sho00561  Glycerolipid metabolism
sho00620  Pyruvate metabolism
sho00625  Chloroalkane and chloroalkene degradation
sho00903  Limonene and pinene degradation
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
sho01120  Microbial metabolism in diverse environments
sho01130  Biosynthesis of antibiotics
Module
sho_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SHJGH_5282
   00053 Ascorbate and aldarate metabolism
    SHJGH_5282
   00620 Pyruvate metabolism
    SHJGH_5282
  Lipid metabolism
   00071 Fatty acid degradation
    SHJGH_5282
   00561 Glycerolipid metabolism
    SHJGH_5282
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SHJGH_5282
   00310 Lysine degradation
    SHJGH_5282
   00330 Arginine and proline metabolism
    SHJGH_5282
   00340 Histidine metabolism
    SHJGH_5282
   00380 Tryptophan metabolism
    SHJGH_5282
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJGH_5282
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SHJGH_5282
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHJGH_5282
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SHJGH_5282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AGF64945
LinkDB All DBs
Position
6000411..6001871
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLARQYIDGEWRPGTGSWDVIDFNPYDDEKLASITVATVDEVDQAYQAAARAQK
KWAETSPYTRRAVFERALRLIEDREQEITDLIIAELGGTRVKAGFELHLAKEFLRESVHL
ALRPEGRILPSPGEGKENRVYRVPVGVVGVISPFNFPFLLSLKSVAPALALGNAVVLKPH
QNTPIAGGTLLAKIFEDAGLPGGLLNVVVTDIAEIGDAFLEHPVPKVISFTGSDKVGRHV
ATVCARNFKRAVLELGGNSALVVLDDADIDYAVDAAVFSRFVHQGQVCMAANRVLVDASV
ADEFTEKFVAKVRGLKVGDPRDPQTVIGPVINSAQAAAVSGTVEQALAEGATALVRGTTT
NNLVEPTVLTGVPAGSPLLQQEVFGPVVFLLTFDGEEEAVRIVNDTPYGLSGAVHTADIE
RGVAFAKRTETGMFHVNDGTVHDEPIVPFGGEKHSGLGRLNGETTLEAFTTVKWISVQHG
RSAFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgacctggcccggcagtacatcgacggcgagtggcggccgggc
accggctcctgggacgtcatcgacttcaacccctacgacgacgagaagctggcctcgatc
acggtggccacggtcgacgaggtggaccaggcctaccaggccgccgcccgcgcccagaag
aagtgggccgagaccagcccctacacccggcgcgcggtcttcgagcgggccctcaggctg
atagaggaccgcgagcaggagataaccgacctgatcatcgcggagctgggcggcacccgc
gtcaaggccggcttcgagctgcacctcgccaaggagttcctgcgcgagtcggtccacctc
gcgctgcgccccgagggccggatcctgccctccccgggcgagggcaaggagaaccgcgtc
taccgcgtgccggtcggcgtcgtgggcgtcatcagccccttcaacttcccgttcctgctg
tcgctgaagtcggtcgcgccggccctcgcgctcggcaacgccgtggtgctcaagccgcac
cagaacaccccgatcgccggcggcaccctgctcgcgaagatcttcgaggacgccgggctg
cccggcggcctgctcaacgtcgtcgtcaccgacatcgccgagatcggtgacgcgttcctt
gagcaccccgtcccgaaggtcatctccttcaccggctcggacaaggtcggccggcacgtc
gccaccgtctgcgccaggaacttcaagcgcgcggtcctcgaactgggcggcaacagcgcc
ctggtggtgctggacgacgccgacatcgactacgcggtggacgcggcggtcttcagccgg
ttcgtgcaccagggccaggtctgcatggccgccaaccgcgtcctcgtggacgcctcggtg
gccgacgagttcaccgagaagttcgtcgccaaggtccgcggtctcaaggtcggcgacccg
cgcgacccgcagaccgtgatcggcccggtgatcaactccgcgcaggcggccgccgtctcc
ggcaccgtggagcaggcgctcgccgagggcgccaccgccctggtgcgcggcaccacgacc
aacaacctggtcgagccgaccgtgctgaccggtgtcccggccggctccccgctgctccag
caggaggtcttcggcccggtcgtcttcctcctcaccttcgacggcgaggaggaggcggtc
cggatcgtcaacgacaccccgtacggcctcagcggcgccgtccacacggccgacatcgag
cgcggcgtggccttcgccaaacggaccgaaaccggcatgttccacgtgaacgacggcacg
gtccacgacgagccgatcgtgcccttcggcggtgagaagcactccggcctcggccgtctc
aacggcgagaccacgctggaggcgttcaccaccgtcaagtggatctcggtgcagcacggg
cgcagcgcgttcccgttctag

DBGET integrated database retrieval system