KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5285Help
Entry
SHJGH_5285        CDS       T02531                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00250  Alanine, aspartate and glutamate metabolism
sho00410  beta-Alanine metabolism
sho00430  Taurine and hypotaurine metabolism
sho00650  Butanoate metabolism
sho01100  Metabolic pathways
sho01110  Biosynthesis of secondary metabolites
sho01120  Microbial metabolism in diverse environments
sho02024  Quorum sensing
Module
sho_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SHJGH_5285
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SHJGH_5285
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SHJGH_5285
   00430 Taurine and hypotaurine metabolism
    SHJGH_5285
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SHJGH_5285
Enzymes [BR:sho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SHJGH_5285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AGF64948
LinkDB All DBs
Position
complement(6003311..6004717)
Genome map
AA seq 468 aa AA seqDB search
MALHRGPDKHEERTMSVNPFFGEANPVGGMTEAPPTHRLPDAALPPSTAYQLVHDELMLD
GNSRLNLATFVTTWMEPQAGVLMDECRDKNMIDKDEYPRTAELERRCVAMLADLWNAPDP
SAAVGCSTTGSSEACMLAGMALKRRWAKRNADRYPGARPNLVMGVNVQVCWEKFCTFWEV
EARTVPMEGDRFHLDPQAAAELCDENTIGVVGILGSTFDGSYEPVADLCAALDALQERTG
LDIPVHVDGASGGMVAPFLDEDLVWDFRLPRVASINTSGHKYGLVYPGVGWALWRDKEAL
PEELVFRVNYLGGDMPTFALNFSRPGAQVVAQYYTFLRLGREGYRAVQQSTRDVATSLAS
RIEALGDFRLLTRGDQLPVFALTTADHVTSYDVFDVSRRLREGGWLVPAYTFPANREDLS
VLRIVCRNGFSHDLADLFLDDLARLLPELRRQPHPLTRDKEAATGFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcacagaggtcccgacaagcacgaggagcggacgatgtcggtcaacccgttc
ttcggggaggccaaccccgtcggcggcatgaccgaggcaccgcccacgcaccggctcccg
gacgccgcgctgccgccgtccacggcgtaccagctggtgcacgacgagctgatgctggac
ggcaactcccggctcaatctggccaccttcgtcaccacctggatggaaccgcaggccggg
gtgctgatggacgagtgccgggacaagaacatgatcgacaaggacgagtacccgcgcacg
gccgagctggagcggcgctgcgtggcgatgctcgcggacctgtggaacgcgccggacccg
tcggcggccgtcggctgttcgacgaccgggtcgagcgaggcctgcatgctcgccgggatg
gcgctgaagcggcgctgggcgaagcggaacgccgaccgctatccgggcgcgcggcccaat
ctggtcatgggcgtcaacgtccaggtgtgctgggagaagttctgcaccttctgggaggtg
gaggcccggacggtcccgatggagggcgaccgcttccatctggacccgcaggccgccgcc
gagctgtgcgacgagaacaccatcggggtcgtcggcatcctcggctcgaccttcgacggc
tcctacgagccggtcgccgacctgtgcgcggccctggacgccctccaggagcggaccggg
ctcgacatcccggtgcacgtggacggcgcgtccggcgggatggtggcgcccttcctggac
gaggacctggtgtgggacttccgcctgccgcgcgtggcgtcgatcaacacctccgggcac
aagtacgggctggtgtatcccggcgtcggctgggcgctgtggcgggacaaggaggcgctg
cctgaggagctggtcttccgggtgaactacctgggcggcgacatgccgaccttcgcgctg
aacttctcccggcccggtgcccaggtggtggcgcagtactacacgttcctgcggctgggc
cgggagggttaccgggcggtgcagcagtcgacgcgggacgtggcgacctcgctcgcctcc
cggatcgaggcgctcggcgacttccggctgctcacgcgcggggaccagctccccgtgttc
gcgctgaccaccgccgaccacgtcacctcgtacgacgtcttcgacgtctcccggcggctg
cgcgagggcggctggctcgtgcccgcctacaccttcccggcgaaccgtgaggacctgtcc
gtgctgcggatcgtgtgccgcaacggcttctcgcacgacctggccgacctgttcctggac
gacctggcccgcctgctgccggagctgcgccgccagccgcaccccctgacccgcgacaag
gaggcggccaccggcttccaccactag

DBGET integrated database retrieval system