KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_5604Help
Entry
SHJGH_5604        CDS       T02531                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho00473  D-Alanine metabolism
sho01100  Metabolic pathways
sho01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SHJGH_5604
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SHJGH_5604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sho01011]
    SHJGH_5604
Enzymes [BR:sho01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SHJGH_5604
Peptidoglycan biosynthesis and degradation proteins [BR:sho01011]
 Precursor biosynthesis
  Racemase
   SHJGH_5604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGF65267
LinkDB All DBs
Position
6343296..6344441
Genome map
AA seq 381 aa AA seqDB search
MPTAALRARAEIDLGALRANVRALRARAEGAALMAVVKSDGYGHGAVPCARAALAAGASW
LGTATAEEALALRAAGLPGRILCWLWVPGGPWRQAIEADIDVSLSGMWALREVVDAARAA
GRTARVHLKADTGLGRNGCQPGEDWAELVGAAVRAEAEGLVRVTGVWSHFACADEPGHPS
VAAQLTRFREMLAYAEEQGVRPEVRHIANSPATLTLPEAHFDLVRTGIALYGVSPSPELG
TPADFGLRPVMTLSASLALVKRTPAGHGVSYGHHYVTPGETTLGLVPVGYADGIPRHASG
TGPVLVGGKWRTIAGRVAMDQFVVDLGGDEPPVGSEAVLFGPGDRGEPTAEDWAQACGTI
AYEIVTRIGTRVPRVYVNASM
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaccgccgccctgcgcgcccgcgccgagatcgatctgggcgccctgcgcgccaat
gtgcgggccctgcgcgcccgggcggagggcgccgcattgatggccgtcgtcaagtccgac
ggatacggccacggcgcggtgccgtgtgcccgcgccgccctcgcggcgggcgcgagctgg
ctcggcacggccacggccgaggaggccctcgcgctgcgcgcggccgggctgcccggccgc
atcctgtgctggctgtgggtgccgggcggaccctggcggcaggcgatcgaggccgacatc
gacgtctcgttgagcggcatgtgggccctgcgggaggtcgtcgacgccgcacgggcggcg
gggcgcaccgcgcgcgtgcacctcaaggccgacaccgggctcggccgcaacggctgccag
ccgggggaggactgggccgagctggtgggtgccgccgtgcgcgcggaggccgaggggctg
gtgcgcgtcaccggggtgtggtcgcacttcgcgtgcgccgacgagccggggcacccgtcc
gtcgccgcccagctcacccggttccgggagatgctggcgtacgccgaggagcagggcgta
cggcccgaggtgcggcacatcgccaactcgccggccaccctcacgctgcccgaggcccac
ttcgacctggtccgcacgggcatcgccctgtacggcgtgtcgcccagcccggagctgggc
accccggcggacttcgggctgcgcccggtgatgacgctcagcgcctcgctggccctggtc
aagcgcaccccggccgggcacggcgtcagctacggccatcactacgtcacgcccggcgag
accacgctgggcctggtgcccgtcggctacgcggacggcatcccgcggcacgcctcgggc
accggcccggtgctggtcggcggcaagtggcggacgatcgccgggcgggtcgccatggac
cagttcgtggtggacctgggcggtgacgagcccccggtgggcagcgaggccgtgctgttc
gggcccggcgaccgcggtgagcccacggccgaggactgggcgcaggcctgcggcacgatc
gcgtacgagatcgtcacgcgcatcggaacgcgcgttccccgcgtctatgtcaacgcgtcc
atgtga

DBGET integrated database retrieval system