KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_6130Help
Entry
SHJGH_6130        CDS       T02531                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Brite
KEGG Orthology (KO) [BR:sho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SHJGH_6130
Enzymes [BR:sho01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SHJGH_6130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N HSR
Motif
Other DBs
NCBI-ProteinID: AGF65793
LinkDB All DBs
Position
complement(6935745..6936140)
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggag
aagatggccggtaacgacgacccccacttccaggcgcgcgccaccgtcatcaaggagcag
cgcgcggagctggccaagcaccacgtctccgtgctctggagcgactacttcaaggccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtccaccgacccggcgacgggccagaaggcgctggactacatcgcccag
atcgacaagattttctgggagaccaagaaggcctga

DBGET integrated database retrieval system