KEGG   Streptomyces hygroscopicus subsp. jinggangensis TL01: SHJGH_7216Help
Entry
SHJGH_7216        CDS       T02531                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sho  Streptomyces hygroscopicus subsp. jinggangensis TL01
Pathway
sho03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sho00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SHJGH_7216
Enzymes [BR:sho01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SHJGH_7216
DNA repair and recombination proteins [BR:sho03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SHJGH_7216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AGF66878
LinkDB All DBs
Position
8186616..8187551
Genome map
AA seq 311 aa AA seqDB search
MSREDARTLRAGRRSVEIKRPGKVLFPGGGGAKEYTKGDLADYYRSVAPYLLPHLRGRPL
MLERYPDGLDGQRFMQKNTPEHYPEWITRAEVAKEGGTVTHVVCDDTATLLYLADQACLT
LHRWLSRTDRAGGPDHPDRLVFDLDPPGDDFGAVREAAAWLRELLDELGLPAAPMTTGSR
GLHLVVPLDGRQDFDAVREFAHDVAELAAARHPDRLTTAARKQDRGDRLYLDVQRNAYAQ
TAVAPFTVRARPGAPVAVPLTWEQLDDPGLDARRWTIADAVDQARTDPWAGLPARGRSLA
PARRRLADMRS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgaggacgcgcggaccctgcgcgcgggccgccgctcggtggagatcaagcgg
ccggggaaggtgctcttccccggcggcgggggcgcgaaggagtacaccaagggcgacctc
gccgactactaccggtccgtcgcgccgtacctgctgccgcacctgcggggccgcccgctg
atgctggaacgctatccggacggcctcgacggccagcggttcatgcagaagaacaccccg
gagcactacccggagtggatcacccgggccgaggtcgccaaggagggcgggacggtcacg
cacgtcgtctgcgacgacaccgcgaccctcctgtacctcgccgaccaggcctgcctgacc
ctgcaccgctggctctcgcgcaccgaccgggccggcggcccggaccaccccgaccggctg
gtcttcgacctcgatccccccggggacgacttcggcgccgtccgcgaggccgccgcctgg
ctgcgcgagctgctggacgaactcggcctgcccgccgcgccgatgaccacgggctcgcgc
ggactgcacctcgtcgtcccgctcgacggccgccaggacttcgacgccgtacgggagttc
gcccacgacgtcgccgaactcgccgccgcacggcacccggaccggctcaccaccgccgcc
cgcaaacaggaccgcggtgaccgcctctacctcgacgtgcagcgcaacgcgtacgcccag
accgccgtcgcgcccttcaccgtccgcgcccgccccggcgccccggtcgccgtccccctc
acctgggagcagctcgacgaccccgggctcgacgcccgccgctggaccatcgccgacgcc
gtcgaccaggcccgcaccgacccgtgggccgggctgccggcccgcgggcgctccctggcc
cccgcccggcgccgtctcgccgacatgcgctcctga

DBGET integrated database retrieval system