KEGG   Staphylococcus hominis: EGX58_03355Help
Entry
EGX58_03355       CDS       T06045                                 

Definition
(GenBank) YSIRK-type signal peptide-containing protein
Organism
shom  Staphylococcus hominis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib YSIRK_signal Gram_pos_anchor
Motif
Other DBs
NCBI-ProteinID: AYY66013
LinkDB All DBs
Position
complement(634363..642048)
Genome map
AA seq 2561 aa AA seqDB search
MLKNTFIKEETSLKSDRYRSFFVFFIKLNKKSINIFLIIISINEDMYFLKFLIFFENICI
VNIILKCYIFIGVLYSINLKNRGVSYLKKKPNRRLDFLPNVQNKYSIRKFTVGAASILVG
ATLIFGAGQEEAKAAESDQTVTNQDNTSSPTDTTEQPSTEEKATSENITTDQPSPEEKAT
SENITTDESSAEEKATESTQTDELSAEEKAAESTQTDESSAEEKVAESTQTDASAEEKAA
ESTQTDESSAEEKAAESTQTDESSAEEKAAESTQTDESSAEEKAAESTQTDESSAEEKAA
ESTQTDESSAEEKAAESTQTDESSAEEKAAESTQTDESSAEEKATESTQTDESLAEEKAA
ESTQTDESSAEEKAAESTQTDESSPEEKEANDSTETNQSSLDKHETTSDVVEQPEASASI
QTISEELNVSSDDTVQALENVGVDTSNATEVEAIAALIQNDYANNSNETPVATPLNVNSA
TARNEETTNTLRPRMFAAMALAADTPTNDNVASNDNNRIIEADAIANGYINSTTDATNAA
NTLSGRAWIVDKGTPATISNGLTPVPEGTPVYMQWIDTDGVTSPIYKAATSNSIGSSDGS
QVGPGAYAFDLREPYIDANGKEHTYRAVSGQYYRIWIEDFKTKNGNTATMLRTAGGFLPG
SYVNSVTSNNIGQFPLIGTNMQRTGIFMGVEPDGEYMTRPQSEWIHDTQGVDSPLSSNSI
QGRVWLETGTGGDLANSATGPSYNPAASDRIADGYTVVFSSLTDEGVQAYKNQVESLPKS
EQVDAARTLLTDHPEYISATVYGETNADGYYTIHFPTDTKINNDYIYGYVMNPDGEKVLG
YSSFTSPIFTGANSDLSFTPQTTPVAKPAKGGWYNVNFALVPTTDTKIDIVNYNNTTQPA
QPGDTVNIDLSGSQLSPLPTHIEWRDSNGNIVQTTDDITSYTDGEQKGTFVVPNSAKAGD
VYTVYLVSGGKDVGSDSFVVATQEKSYQPTTDEVTKDYGDPTTEGDITGAVTIPDYPSEK
GTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTDEV
TKDYGDPTTEGDITGAVTVPDYPSEKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGT
QDHVTVPVTTNEQADNDAYQPTTDEVTKDYGDPTTEGDITGAVTVPDYPSEKGTPTITVD
DPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTDEVTKDYGDPT
TEGDITGAVTIPDYPSEKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPV
TTNEQADNDAYQPTTDEVTKDYGDPTTEGDITGAVTTPDYPSEKGTPTITVDDPSTLPDG
NTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTDEVTKDYGDPTTEGDITGA
VTVPDYPSEKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADN
DAYQPTTDEVTKDYGDPTTEGDITGAVTIPDYPSEKGTPTITVDDPSTLPDGNTPGTVNV
PVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTDEVTKDYGDPTTEGDITGAVTIPDYPS
EKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTD
EVTKDYGDPTTEGDITGAVTVPDYPSEKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPD
GTQDHVTVPVTTNEQADNDAYQPTTDEVTKDYGDPTTEGDITGAVTIPDYPSEKGTPTIT
VDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTDEVTKDYGD
PTTEGDITGAVTIPDYPSEKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTV
PVTTNEQADNDAYQPTTDEVTKDYGDPTTEGDITGAVTIPDYPSEKGTPTITVDDPSTLP
DGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQADNDAYQPTTNEVTKDYGDPTTEGDIT
GAVTIPDYPSEKGTPTITVDDPSTLPDGNTPGTVNVPVTVTYPDGTQDHVTVPVTTNEQA
DNDAYQPTTDEVTKDYGDPTTEGDITGAVTIPDYPSEKGTPTITVDDPSTLPDGNTPGTT
EVDVTVTYPDGTKDHVKVPVTVGEETQANTNDPSYDNVTVDPGETIKVPQTGDNTMPDGT
QYEIDKSKIPSGWEVTVDHNTGELTVKPSEDAVPGTSIVIPVTVTYPDGSTEEASTTITV
GDVIDIPAPTVNPVDDNDTEVTGTDGTPGNTIVVTFPDGSTSEGNIDEDGNWTVDIPDGV
DLDKGDVITVVEKDKDGKVSTPTKVVVGENCDNPSNGDNSGDGAGNDSSDGDNSEDGAGN
DSSDGDNSGDGAGNDSSDGDNSEDGAGNDSSDGDNSEDGADKGSSNEDNSKDEEGNNSLD
SNNSVEGNKDSLTDNNATTDSNNTASVNNTDQTDSNNDVSELNEDNNTSNNTHKQNNSEA
KALPETGNNEQNNGTLLGSLFAAAGTLFLAGKRRKNRTDKK
NT seq 7686 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaacacatttataaaagaagaaactagtttaaagagcgatagatatcgctct
ttttttgttttttttattaaattaaataaaaaaagtattaatatttttttaataattatt
agtatcaatgaagacatgtattttctaaaatttctgatatttttcgaaaatatatgtatt
gtcaatataatattaaaatgttatatttttatcggagtattgtactcaattaatttgaaa
aataggggtgtgagttatttgaaaaagaaaccaaatagaagattagatttcttacctaat
gttcaaaacaaatactcaattagaaaatttacagtaggagcggcatctattttagtaggt
gcaacattaatctttggggcagggcaggaagaagcaaaagctgccgaatcagatcaaaca
gtaacaaatcaagataatacatcttcacctactgatacaacggaacaaccatcaacagaa
gaaaaagcgacaagtgagaacataacaacagaccaaccatcaccagaagaaaaagcaaca
agtgaaaacataacaacagatgaatcatcagcagaagaaaaagcgactgaaagtactcaa
acagatgaattatcagcagaagaaaaagcggctgaaagtactcaaacagatgaatcatca
gcagaagaaaaagtggctgaaagtactcaaacagatgcatcagcagaagaaaaagcggct
gaaagtactcaaacagatgaatcatcagcagaagaaaaagcggctgaaagtactcaaaca
gatgaatcatcagcagaagaaaaagcggctgaaagtactcaaacagatgaatcatcagca
gaagaaaaagcggctgaaagtactcaaacagatgaatcatcagcagaagaaaaagcggct
gaaagtactcaaacagatgaatcatcagcagaagaaaaagcggctgaaagtactcaaaca
gatgaatcatcagcagaagaaaaagcggctgaaagtactcaaacagatgaatcatcagca
gaagaaaaagcgactgaaagtactcaaacagatgaatcattagcagaagaaaaagcggct
gaaagtactcaaacagatgaatcatcagcagaagaaaaagcggctgaaagtactcaaaca
gatgaatcatcaccagaagaaaaagaagcaaatgacagtacagaaacaaaccaatcatca
ttagacaaacatgaaacaactagtgatgttgttgaacaacctgaagctagtgcttcaatt
caaaccatctctgaagagttaaatgtatcaagtgatgatacagttcaagctctagaaaat
gttggagtagatacatctaatgcaacagaagtagaagctattgctgcacttattcaaaat
gattatgcaaataatagtaacgaaacaccagttgctacaccattaaacgtaaattcagca
actgcacgtaatgaagaaacaacaaatacactaagaccaagaatgttcgctgcgatggcg
ttagctgccgatacgccaacaaacgataatgttgctagtaatgataacaatagaatcatt
gaagctgatgcaattgcaaacggttatattaattcaactacagacgcaacgaatgctgcg
aacacattatcaggacgtgcatggattgttgataagggtacacctgcaactatatctaat
ggattgacaccggttcctgaaggtacacctgtttatatgcaatggattgatacagacggt
gtaacgtctccaatttataaagcagcaacttcaaattcaattgggagctctgatggttca
caggtagggcccggagcgtatgcgtttgatttaagagaaccatatatagatgcaaatggt
aaagaacatacgtatcgtgcagttagtggacaatactatcgtatctggattgaagatttt
aaaactaaaaacggaaatacagcaacaatgttacgtacagcaggcggttttttaccaggt
tcgtatgtaaattcagttactagtaataatattggccagttcccattaataggtacaaat
atgcaacgtacaggtatctttatgggtgttgaacctgatggtgaatatatgactcgacca
caatctgagtggattcatgatactcaaggcgttgatagtccactttcttcaaactctata
cagggtcgtgtatggttagaaacaggaactggtggagatttagctaactcagcaactggt
ccaagctacaacccagctgcaagtgatagaatagcagatggttatactgttgtattttca
tctttaactgatgaaggtgttcaagcatataaaaatcaagtggaaagtttaccaaaatca
gaacaagtagacgcagcaagaactttattaacagatcatcctgaatacatttcagcaaca
gtttatggtgagacaaatgcggatggatattatactattcacttcccaacagatacaaaa
attaacaatgattatatttatggttatgtaatgaatcccgatggagaaaaagtactagga
tattcttcatttacctcaccaatttttactggagcaaattcagatttatcatttacgcct
caaacaacaccagttgctaaaccagccaagggtggatggtataatgtaaactttgcatta
gttccgacaacagatactaaaattgatattgtgaattacaataacactacacaaccagca
caacctggtgacacggttaatattgatttaagcggttcacaattatcaccacttccaact
catatagagtggagagatagcaatggtaatatagttcaaacaacggatgacattacttca
tatactgatggtgaacaaaaaggtacatttgtagttcctaattctgcaaaagccggggat
gtttatacagtttatcttgtttcaggtggtaaagatgtaggttctgattcattcgtagtt
gctactcaagagaaatcataccaaccaacaacagacgaggttacaaaagattacggtgac
ccaacaactgagggagatatcacaggcgcagtaacaattccagattatccatcagaaaaa
ggaacaccaactatcacagttgatgatccaagtacattaccggacggtaatacgccagga
acagtcaacgttccagtaacggtaacttatccagatggcacacaagatcatgtgacagta
ccagtgacaacaaatgaacaagcagataatgatgcttaccaaccaacaacagacgaggtt
acaaaagattacggtgacccaacaactgagggagatatcacaggcgcagtaacagttcca
gattatccatcagaaaaaggaacaccaactatcacagttgatgatccaagtacattaccg
gacggtaatacgccaggaacagttaacgttccagtaacggtaacttatccagatggcaca
caagatcatgtgacagtaccagtgacaacaaatgaacaagcagataatgatgcttaccaa
ccaacaacagacgaggttacaaaagattacggtgacccaacaactgagggagatatcaca
ggcgcagtaacagttccagattatccatcagaaaaaggaacaccaactatcacagttgat
gatccaagtacattaccggacggtaatacgccaggaacagtcaacgttccagtaacggta
acttatccagatggcacacaagatcatgtgacagtaccagtgacaacaaatgaacaagca
gataatgatgcttaccaaccaacaacagacgaggttacaaaagattacggtgacccaaca
actgagggagatatcacaggcgcagtaacaattccagattatccatcagaaaaaggaaca
ccaactattacagttgatgatccaagtacattaccggacggtaatacgccaggaacagtc
aacgttccagtaacggtaacttatccagatggcacacaagatcatgtgacagtaccagtg
acaacaaatgaacaagcagataatgatgcttaccaaccaacaacagacgaggttacaaaa
gattacggtgacccaacaactgagggagatatcacaggcgcagtaacaactccagattat
ccatcagaaaaaggaacaccaactatcacagttgatgatccaagtacattaccggacggt
aatacgccaggaacagtcaacgttccagtaacggtaacttatccagatggcacacaagat
catgtgacagtaccagtgacaacaaatgaacaagcagataatgatgcttaccaaccaaca
acagacgaggttacaaaagattacggtgacccaacaactgagggagatatcacaggcgca
gtaacagttccagattatccatcagaaaaaggaacaccaactatcacagttgatgatcca
agtacattaccggacggtaatacgccaggaacagttaacgttccagtaacggtaacttat
ccagatggcacacaagatcatgtgacagtaccagtgacaacaaatgaacaagcagataat
gatgcttaccaaccaacaacagacgaggttacaaaagattacggtgacccaacaactgag
ggagatatcacaggcgcagtaacaattccagattatccatcagaaaaaggaacaccaact
attacagttgatgatccaagtacattaccggacggtaatacgccaggaacagttaacgtt
ccagtaacggtaacttatccagatggcacacaagatcatgtgacagtaccagtgacaaca
aatgaacaagcagataatgatgcttaccaaccaacaacagacgaggttacaaaagattac
ggtgacccaacaactgagggagatatcacaggcgcagtaacaattccagattatccatca
gaaaaaggaacaccaactatcacagttgatgatccaagcacattaccggacggtaatacg
ccaggaacagtcaacgttccagtaacggtaacttatccagatggcacacaagatcatgtg
acagtaccagtgacaacaaatgaacaagcagataatgatgcttaccaaccaacaacagac
gaggttacaaaagattacggtgacccaacaactgagggagatatcacaggcgcagtaaca
gttccagattatccatcagaaaaaggaacaccaactatcacagttgatgatccaagtaca
ttaccggacggtaatacaccaggaacagtcaacgttccagtaacggtaacttatccagat
ggcacacaagatcatgtgacagtaccagtgacaacaaatgaacaagcagataatgatgct
taccaaccaacaacagacgaggttacaaaagattacggtgacccaacaactgagggagat
atcacaggcgcagtaacaattccagattatccatcagaaaaaggaacaccaactatcaca
gttgatgatccaagtacattaccggacggtaatacgccaggaacagttaacgttccagta
acggtaacttatccagatggcacacaagatcatgtgacagtaccagtgacaacaaatgaa
caagcagataatgatgcttaccaaccaacaacagacgaggttacaaaagattacggtgac
ccaacaactgagggagatatcacaggcgcagtaacaattccagattatccatcagaaaaa
ggaacaccaactatcacagttgatgatccaagcacattaccggacggtaatacgccagga
acagttaacgttccagtaacggtaacttacccagatggcacacaagatcatgtgacagta
ccagtgacaacaaatgaacaagcagataatgatgcttaccaaccaacaacagacgaggtt
acaaaagattacggtgacccaacaactgagggagatatcacaggcgcagtaacaattcca
gattatccatcagaaaaaggaacaccaactatcacagttgatgatccaagtacattaccg
gacggtaatacgccaggaacagttaacgttccagtaacggtaacttatccagatggcaca
caagatcatgtgacagtaccagtgacaacaaatgaacaagcagataatgatgcttaccaa
ccaacaacaaacgaggttacaaaagattacggtgacccaacaactgagggagatatcaca
ggcgcagtaacaattccagattatccatcagaaaaaggaacaccaactatcacagttgat
gatccaagcacattaccggacggtaatacgccaggaacagtcaacgttccagtaacggta
acttatccagatggcacacaagatcatgtgacagtaccagtgacaacaaatgaacaagca
gataatgatgcttaccaaccaacaacagacgaggttacaaaagattacggtgacccaaca
actgagggagatatcacaggcgcagtaacaattccagattatccatcagaaaaaggaaca
ccaactattacagttgatgatccaagtacattaccggacggtaatacaccaggaacaaca
gaagtagatgtgacggtaacgtatccagatggaacaaaagatcatgttaaagtccctgta
acagtcggagaagaaacacaagcgaatactaatgatccaagttatgataatgtaacagta
gatcctggagaaacaatcaaagtgccacaaactggtgataatacaatgccggatggcact
caatatgaaattgataaatcgaaaattccatcaggatgggaagtaacagttgaccataat
actggtgaattaactgtaaaaccttcggaagatgcagtaccaggaacatctatagttata
ccagtgacggtaacgtatccagatggttctacagaagaagcatcaacaacgattacagta
ggtgatgtgattgatattccagcgccaacggttaacccggttgatgataatgatactgaa
gttacgggaacagatggtacaccaggcaacacaattgtggttacattcccagatggtagt
acttcagaaggcaacattgatgaggatggtaattggactgttgatattccagacggcgta
gaccttgataaaggtgatgtaattactgttgttgaaaaagataaagatggtaaagtatct
accccaacaaaagttgttgtaggagaaaattgtgataatccatcaaatggagacaactca
ggagatggagcaggcaatgattcatcagatggagataactcagaagatggagcaggcaat
gattcatcagatggagataactcaggagatggagcaggcaatgattcatcagatggagat
aactcagaagatggagcaggcaatgattcatcagatggagataactcagaagacggagca
gataaaggctcatcaaatgaagataattcaaaagatgaagaaggtaataactctttagat
agtaataattcagttgaaggaaataaagatagtctaactgataataacgctactacagat
tcaaataatactgcgtctgttaacaacactgatcaaacagattcaaacaatgacgtatca
gagttaaatgaagataataatacttcaaataatactcataaacaaaataatagtgaagct
aaagcattacctgaaacaggtaataatgaacaaaataatggcactttacttggctcttta
tttgctgctgctggtacgctcttcttagcaggaaaacgtcgtaaaaatagaacagataaa
aagtag

DBGET integrated database retrieval system