KEGG   Staphylococcus hominis: EGX58_04190Help
Entry
EGX58_04190       CDS       T06045                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
shom  Staphylococcus hominis
Brite
KEGG Orthology (KO) [BR:shom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGX58_04190 (ahpF)
Enzymes [BR:shom01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGX58_04190 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C Thi4 FAD_binding_3 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AYY66154
LinkDB All DBs
Position
807536..809059
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLQLMEGDVEFRASIGSDDKSKELKDLLDEIAEMTDHITIVEKELKRT
PSFQVSKPEEDTGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQAIIDQIKGLEGNYNFE
TYVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESKDIMAVPAVFLDGEEFGNG
RMTISDILSKLGSTQDASEYENKDPYDVLIIGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKQTTGSEFSSNLAAHIEEYDIDAMTGIRATKIEKTDKAIRVTLEND
AVLESKTAIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKNVAVIGGGNSGVEA
AIDLAGIVKHVTLFEFDPELKADTVLQERLRSFPNVDIHTNARTAEVLGEDHVTGLSYED
MSSGEMKELSLDGIFVQIGLVPNTKWIGDAVELNNRGEVVVDRENNTNVPGIFAAGDVTD
QKYKQIIISMGSGANAALSAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgctgatttaaaacaacaattacaacaattattacaacttatggaaggcgat
gtagaatttagagcaagtattggctctgatgataaatctaaagaattaaaagatttatta
gatgaaatcgctgagatgacagatcatattacaatcgttgaaaaagaattaaaacgcaca
ccaagtttccaagtaagtaaacctgaagaagatactggtatcacatttgctggtattccc
ttaggtcatgagttcaattcacttgtgcttgctattttacaagtaagtggtcgtgcgcct
aaagaaaaacaagcaatcattgatcaaattaaaggtcttgaaggcaactacaattttgag
acttatgtaagtttaacttgtcaaaaatgtccagatgtagttcaagcattaaatttaatg
agtgtaattaatccaaatatcactcatacaatgattgatggtgctgtattccgtgaagag
tctaaggatatcatggcagttcctgctgtatttttagatggtgaagaattcggtaatggt
cgtatgacaatttctgatattttatctaaacttggcagtacacaagatgcttcagaatat
gaaaataaagatccatacgatgtattaatcatcggtggtgggccagcaagtggtagtgct
gcaatttatactgcgcgtaaaggtttacgcactggtattgttgcagatagaatcggtggt
caagttaatgatacagctggcattgaaaactttattactgttaaacaaaccactggatca
gaattctcttctaatttagctgcacatatcgaagaatatgatattgatgctatgactggt
attcgtgcaactaaaattgaaaaaactgataaagctatccgagtaactttagaaaatgat
gcagttcttgaaagtaaaactgctattatttcaacgggtgcaagctggcgtaaattaaat
attcctggtgaagatcgcttaatcaataaaggtgtggctttctgtcctcactgtgacgga
cctttatttgaaaataaaaacgttgcagttatcggcggtggtaactctggtgttgaagca
gctatcgatttagcaggaatagttaaacatgtgacactatttgaattcgatccagaacta
aaagcggatacagtgttacaagaacgtttacgttctttccctaatgttgatattcacaca
aatgctagaactgctgaagttctaggtgaagatcatgttactggtttaagctatgaagat
atgtcatctggtgaaatgaaagaattaagcttagatggtatctttgtacaaattggcctt
gtgccaaatacaaaatggattggtgacgcagtagagttaaataaccgtggagaagtcgtt
gtggatcgtgaaaataacacaaacgttcctggtatttttgctgctggtgacgttactgac
caaaaatataaacaaatcattatatcaatgggttcaggtgctaacgcagcattgagtgca
tttgattatattattagaaattaa

DBGET integrated database retrieval system