KEGG   Shewanella putrefaciens 200: Sput200_1449Help
Entry
Sput200_1449      CDS       T02015                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:shp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Sput200_1449
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shp02000]
    Sput200_1449
Enzymes [BR:shp01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Sput200_1449
Transporters [BR:shp02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Sput200_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_23 ABC_ATPase AAA_29 AAA_15 AAA_16 AAA_30 Rad17 NB-ARC AAA_18 AAA_25 ATPase_2 AAA AAA_33 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: ADV53913
UniProt: E6XS08
LinkDB All DBs
Position
1637903..1638721
Genome map
AA seq 272 aa AA seqDB search
MISIDSTAMKTNTFDLANLSQNDTALEIRNLDLRYGDKQALFNVSMKIPKKQVTAFIGPS
GCGKSTLLRCINRMNDLVDNCYIDGEILLHGQNIYDKKIDVAALRRNVGMVFQRPNPFPK
SIYENVVYGLRLQGINNRRDLDEAAERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIA
RAIAIEPEVLLLDEPTSALDPISTLTIEELITELKTKYTVVIVTHNMQQAARVSDQTAFM
YMGELVEYADTNTIFTTPKKRKTEDYITGRYG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatttctatagattcaacagcaatgaaaacgaacacctttgatttggcgaacttaagc
cagaacgataccgctctggagatccgcaacttagatttgcgctatggcgataagcaagcg
ctgtttaatgtatcgatgaagatccccaagaagcaagtcacagcctttatcggccccagc
gggtgcggtaaatcgaccttactgcgctgcattaaccgtatgaacgatttagtggataac
tgctatatcgacggcgagattttgctgcacggtcaaaatatttacgacaaaaaaattgat
gtggcagccctgcgtcgaaatgtgggcatggtgttccaacgtccaaatccatttccaaag
tcgatctatgagaacgtggtttacggcttacgcttgcaaggcattaataatcgtcgagac
ttagatgaagccgctgagcgttcactgcgcggcgcggctatttgggatgaagtgaaagac
agattgcacgataacgcttttggtttatcgggtggtcaacagcaacgtctggtgattgcc
cgtgcaattgcgattgagccagaagtgctattactcgacgaacccacatcggcactcgat
cctatttcaaccttaaccattgaagagttaatcactgagctgaaaaccaaatataccgtg
gtgatagtgactcacaatatgcaacaggcggcacgggtatcggatcaaactgcttttatg
tatatgggtgaattagtggaatatgcggataccaataccattttcactacgccgaaaaaa
cgtaaaacggaagattacatcaccggacgttacggttaa

DBGET integrated database retrieval system