KEGG   Shewanella putrefaciens 200: Sput200_1479Help
Entry
Sput200_1479      CDS       T02015                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00250  Alanine, aspartate and glutamate metabolism
shp00410  beta-Alanine metabolism
shp00430  Taurine and hypotaurine metabolism
shp00650  Butanoate metabolism
shp01100  Metabolic pathways
shp01110  Biosynthesis of secondary metabolites
shp01120  Microbial metabolism in diverse environments
shp02024  Quorum sensing
Module
shp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Sput200_1479
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sput200_1479
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sput200_1479
   00430 Taurine and hypotaurine metabolism
    Sput200_1479
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sput200_1479
Enzymes [BR:shp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Sput200_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADV53943
UniProt: E6XFR1
LinkDB All DBs
Position
complement(1670607..1672256)
Genome map
AA seq 549 aa AA seqDB search
MTQKLPRQATASEESLMRIFTVPEDAESTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFKIPTQPRFVSDYTDEIMQNLVAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHQLIYAQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVTREGLLKALRYYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTDSHNKVDIAKMREAALELARKNIKVLAIVGVAGTTETGNVDPLIELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGLDGYEILINNSIEKARYFAE
QIKAHKDFELVTEPELCLLTYRYVPAKVQAAMQVAIEQGDTAKLARFNELLDGLTQFIQK
HQREQGKSFVSRTRISPARYFRQATVVFRVVLANPLTSHEILNQVLVEQSEIAALDKEFL
PALLAMVAE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaaactccctcgtcaagccacggcatctgaagaaagcctaatgcgtatattt
accgtgcccgaagatgcagaatcgacgctaagtattatcgagcagaagctttccgaggat
ttagcaggctttttgggtgacagcattgccgcgctcgaaaaacctttgtcggaaatcgaa
accgattttcaagcctttaagatcccaactcagcctcgttttgtctccgattacaccgat
gaaattatgcaaaatctggtggcgcattcggtacatacctctgcgccaagttttattggt
catatgacatcggccctgccttactttgtgttgcccctgtcgaaaatgatggtaggtctg
aatcaaaatctggtcaaaatcgaaacttctaaggcatttacaccgcttgagcgccaagtg
ctcggcatgatgcaccaattgatttacgcccaagacacggatttttatcaaagctggatg
cacagtgcgaatcattccctcggggctttttgttcaggcggtacggttgccaatatcacg
gcgctgtggattgcccgtaaccaattattaaaggcagatggtgagtttaaaggtgttacc
cgcgaagggctactcaaggcgctgcgctattatggttatgatgatttagcgattttggtc
tcggaacgcgggcattactccctaggtaaagcggtcgatctgctcggtattggtcgcgat
aatatcattagtattcccacggatagccacaataaagtcgatatcgccaagatgcgcgaa
gcggcgcttgaacttgcccgtaaaaatatcaaggtattggccattgttggcgtggctggt
acaaccgaaaccggtaatgtcgacccgctgattgagttagctgcgctggcaaaagagcta
aattgccatttccatgtagatgcagcatggggaggtgcgagtttattatccaataaatac
cgccacttactcgcaggtatcgaacttgctgattcggtgactattgatgcccataagcag
atgtatgtgcctatgggcgctggcatggtgttatttaaaaaccccgagtttgcccacgcc
attgcccaccatgcagaatatattttgcgccgtggttcaaaggatttaggcagccaaacc
ttagaaggctcgcgccccggcatggcgatgttagtgcacgcttgcttacagatcatcggc
ctcgatggttatgaaatcttaatcaataacagcattgaaaaagcccgttattttgccgaa
caaatcaaagcccataaggattttgagctagtcactgagcctgaactttgcctactaacc
tatcgttatgtgcccgccaaggtgcaagccgcgatgcaagtggcgattgagcaaggtgac
actgcaaaacttgcacgctttaatgaactgctcgatgggcttacccagtttattcaaaag
caccagcgcgaacagggcaaatccttcgtctcccgcacccgcatctcccccgcccgctat
tttaggcaagcgaccgtggtgtttcgcgtagtactcgccaaccccctcaccagccatgaa
attctaaatcaagtgctggtcgagcaaagcgaaatcgccgcattagataaagagtttcta
cccgcgctattggcgatggtggctgaatag

DBGET integrated database retrieval system