KEGG   Shewanella putrefaciens 200: Sput200_1706Help
Entry
Sput200_1706      CDS       T02015                                 

Definition
(GenBank) Fe/Mn superoxide dismutase, SodB
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
shp  Shewanella putrefaciens 200
Brite
Enzymes [BR:shp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sput200_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADV54165
UniProt: E6XI61
LinkDB All DBs
Position
complement(1939309..1939893)
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKNALEPHISQETIEYHYGKHHNTYVVKLNGLIEGTDFADKSLEEIIKTS
TGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGPVADAINAAFGSFEAFKAQFTDSAVNNFG
SAWTWLVKKADGTVAIVNTSNAATPLTDSTVTPILTVDVWEHAYYIDYRNVRPDYLAHFW
QLVNWDFVNQNYAG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattacccgcattaccatatgcaaagaacgcactagaaccacacatttct
caagaaaccattgaataccactacggcaagcatcacaacacttatgttgttaagctaaac
ggcttaatcgaaggaactgatttcgcagacaaatctttagaagaaatcatcaaaacttct
actggtggtgtatttaacaacgcagctcaagtgtggaaccacactttctactggaactgt
ttagcacctaacgctggcggcgagccaacaggtcctgtggcagatgccatcaatgcagcc
ttcggttcatttgaagcatttaaagcccaatttaccgattctgctgtgaataacttcggt
agcgcttggacttggttagtgaaaaaagccgatggtactgtggctatcgttaacacgagc
aacgccgcaacaccactgactgacagcactgtcacgccaattctgaccgttgacgtatgg
gaacacgcctactacatcgattatcgtaacgtgcgtccagactatttagcccacttctgg
caattagtgaactgggacttcgtgaaccaaaactacgcgggttaa

DBGET integrated database retrieval system