KEGG   Shewanella putrefaciens 200: Sput200_2279
Entry
Sput200_2279      CDS       T02015                                 

Definition
(GenBank) two component sensor histidine kinase, PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp01503  Cationic antimicrobial peptide (CAMP) resistance
shp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sput200_2279
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Sput200_2279
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shp01001]
    Sput200_2279
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:shp02022]
    Sput200_2279
   01504 Antimicrobial resistance genes [BR:shp01504]
    Sput200_2279
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Sput200_2279
Protein kinases [BR:shp01001]
 Histidine kinases
  OmpR family
   Sput200_2279
Two-component system [BR:shp02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   Sput200_2279
Antimicrobial resistance genes [BR:shp01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    Sput200_2279
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 DUF148 FlgN HAMP Microvir_H
Other DBs
NCBI-ProteinID: ADV54726
UniProt: E6XNV6
LinkDB
Position
2601493..2602842
AA seq 449 aa
MQLKFTFKKRLLTRMFLTSLSIITLVGFGLAWMVNILHAQNSYNEETAQLIAEIPQVAAE
LREHDLIPDTSAWLEENNKQERYVIASCDDKFKQVWTSSLAVDRGLFDTCERFNEIRNDS
PPYYLTMADERGYFVYLLAVEIAGVHYNLLVMKDAEKLEQEYSKFSKRTYMRLAMVLALA
LILLVSAAYWGMRPLVLMQNELQSINEGKTKSLSEGYPVELEGVTQALNQMLQQSSAQQQ
RYQNAMNDLAHSLKTRLAAVHAITDDTSLSKQSANEKIMEQISQMDQLVKYQLKRAMLGR
QGLKQEHTAIAPLVDQLSQMLFKIYRDKQVNFIAKIAPNLQFPGNKGDLMELCGNLMENA
FRLCISQVQLSAHFNALGEFELIVEDDGPGVEETLRQKIIQRGVRADTQSPGQGIGLAVC
DEIVHSYGGTLDIEESHLEGALFRIRIPV
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcaactaaaatttacctttaagaaacgtctgctcacgcggatgtttctcacctcacta
tcaataatcactttagtgggttttggcttagcgtggatggtgaatattctgcacgcgcaa
aatagttacaacgaagaaactgcccaactcattgccgaaatacctcaagtcgccgcagag
ttaagggaacatgatctcattcctgataccagcgcatggctcgaagaaaataacaaacaa
gaacgctatgttatcgctagttgtgatgacaagttcaaacaggtatggacatcatcactc
gcagtcgatcgtggtttatttgatacctgcgaacgttttaatgaaatccgtaacgattca
ccgccctattatctaaccatggccgatgaaagaggctactttgtctatttactcgcagta
gaaattgcaggcgtacactataacctgctggtgatgaaagatgccgagaaacttgaacaa
gaatacagtaaattcagtaagcggacttacatgcgcttagccatggtattggccttagcc
ttaattttactcgtcagtgctgcctattggggaatgcgccctctggtactgatgcaaaat
gagttgcaatcgatcaatgaaggtaaaactaaatccctatcagagggttaccctgttgag
ttagaaggggtaactcaagcactgaaccaaatgttacaacaatcaagtgcccagcaacaa
cgctatcaaaatgcgatgaacgatttagctcacagccttaaaactcgtctagccgcagtc
catgccatcactgacgatacgagtctaagcaagcaatctgctaatgaaaagattatggag
caaataagccagatggatcaactggttaaatatcagctcaagcgcgcgatgctcggccgt
caaggactaaaacaagagcataccgctatagcaccactggttgatcagctttcgcagatg
ctatttaaaatttatcgcgataaacaagttaactttatcgccaagatagcacctaactta
cagtttccaggtaacaaaggtgatctaatggaactgtgtggaaacttaatggaaaatgct
tttcgactatgtattagccaagtacagctcagtgctcattttaatgcactgggtgaattt
gaattaatcgtcgaagatgatggaccaggtgtagaggaaacactgcggcaaaagataatc
caacgcggtgtacgtgccgatacacaatcgccaggtcaaggtattggtttagccgtatgc
gatgaaattgttcacagttatggtgggacactcgatattgaagaaagtcatttggaaggg
gctctttttaggatccgcatcccagtctaa

DBGET integrated database retrieval system