KEGG   Shewanella putrefaciens 200: Sput200_2879
Entry
Sput200_2879      CDS       T02015                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp03030  DNA replication
shp03430  Mismatch repair
shp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:shp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Sput200_2879
   03430 Mismatch repair
    Sput200_2879
   03440 Homologous recombination
    Sput200_2879
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shp03032]
    Sput200_2879
   03400 DNA repair and recombination proteins [BR:shp03400]
    Sput200_2879
Enzymes [BR:shp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sput200_2879
DNA replication proteins [BR:shp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sput200_2879
DNA repair and recombination proteins [BR:shp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Sput200_2879
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: ADV55283
UniProt: E6XID2
LinkDB
Position
3246623..3247135
AA seq 170 aa
MTQALFYLMPPVAQSGHIAIQSAISTVANTNVALGAMHLFACQLAQQAYIKQQLVYIHCQ
DKNLALEIDELLWQFEPTAFVPHNLKGEGPITGAPVEIGFDRLGANKSRQLLINIADQAP
PFAVNFGQIIDFVANDDQHKAVARERYRQYRDLGIELTTHNLATHPLNLV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgactcaagcgctgttttatctgatgccaccagtggcacaatctggtcatatcgcgatc
cagtcagccataagcactgtagccaataccaatgtggctttaggagcaatgcaccttttt
gcatgtcaattagctcagcaagcttatattaagcaacaattagtctatattcattgtcaa
gacaaaaacttagctttagagattgatgaattattatggcaatttgagccaacagcattc
gtacctcacaacttgaaaggtgaaggacctatcactggtgccccagttgaaataggtttt
gaccgccttggggccaataaaagtcgtcaacttctgattaatattgcagaccaagccccc
ccatttgcggtaaactttggtcaaatcatcgattttgttgccaatgacgatcagcataaa
gccgttgcccgtgaacgctataggcaatatcgcgacctagggatcgaattaacgacccat
aatttagcaacacatccacttaatttagtttga

DBGET integrated database retrieval system