KEGG   Shewanella putrefaciens 200: Sput200_4030Help
Entry
Sput200_4030      CDS       T02015                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
shp  Shewanella putrefaciens 200
Pathway
shp00620  Pyruvate metabolism
shp00680  Methane metabolism
shp01100  Metabolic pathways
shp01120  Microbial metabolism in diverse environments
shp01200  Carbon metabolism
Module
shp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:shp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sput200_4030
  09102 Energy metabolism
   00680 Methane metabolism
    Sput200_4030
Enzymes [BR:shp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sput200_4030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF3666
Motif
Other DBs
NCBI-ProteinID: ADV56388
UniProt: E6XIH4
LinkDB All DBs
Position
4495326..4497995
Genome map
AA seq 889 aa AA seqDB search
MSVNAADNMTDMYASLRSNVSMLGQILGDTMRTHLGDSFLEKVEQIRKLAKDSRRGDQAA
REQMLELLTALPDEELVPFAKAFNQFLNLANLSEQFHTISRNCDELVCVPDPVEQLLGRM
LNGRVDQAKMLDCLKTLDIDLVLTAHPTEISRRTLIQKYAAIVDCLTEQENDQLSDRERQ
QISLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLRQLNDQVQQRT
GQQLPIDIAPVRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHAAARLFLKDIVLLVGELSM
EEANDELKAYTNNSCEPYRHVLRSIRQRLRDTIDYLNARIEGHNPEVDKSSLIWQESDLK
APLEMLYKSLTDCGMRLIANGLLLDILRRLACFGIHMLRLDIRQDASRHSDVLAELTRYL
GMGDFNHWDETEKQAFLLRELSNRRPLIPSNWQPSADVAEVLNTCRLIAKHPAKALGSYV
ISMAGKPSDVLTVLLLLKETGCSHPMRVVPLFETLSDLNNAAACITDLLDIDWYRGYTKG
MQEVMIGYSDSAKDAGVMAAAWAQYHAQEQLVAVCKQAGVKLTLFHGRGGSIGRGGGPAH
KAILSQPPGSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVLEATLLPPPEPKQEW
RNCMQRIAEESVGAYRGIVRDEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLR
AIPWIFAWSQNRLMLPAWLGAGEALQAASERGEMGLLQDMEREWPFFSTRISMLEMVYAK
AEPNLARYYETCLVPKDLHHLGETLRQRLDLGIKVVLELTKSDSLMAHTPWNRESVKLRN
PYIDPLNFLQTELLARTRKETTETPASEHVQLALMLTIAGVAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaacgcggcagacaatatgacagatatgtatgcgtcattaagatcgaacgtg
agtatgttaggccaaatccttggcgatactatgcgaacccatcttggggactcttttctt
gagaaagttgaacagatccgtaaacttgccaaagactcacgcagaggcgatcaagccgcc
agagagcaaatgctcgagttactcacggcactgccagacgaagaattagttccttttgca
aaggcattcaatcagttccttaacttagccaatttatctgaacaatttcatactatcagt
cgtaattgcgacgaacttgtctgcgtaccagacccagtggaacaactcctaggccgcatg
ctcaatggtcgtgtcgaccaagctaaaatgctcgactgtctaaaaacactggatatcgat
ctggtgctaacagcgcaccccactgaaatttcccgtcgcaccctgatccaaaagtacgcc
gccattgtcgactgcttaactgagcaagaaaacgaccaattatcagatagagagcgtcag
caaatcagtctgcgcctgcgccaattgatcgcgcaaatctggcacaccaatgagatccgc
cgtgagcgcccaacacctgttgatgaagcccgctggggattatcgaccattgaagagtca
ctttggcatgcggtgccagacttcttaagacagcttaacgaccaagtgcagcaacgcacg
ggtcaacaattaccgattgatatcgcgccagtgcgtttttcaagctggatgggcggcgat
cgcgacggcaacccgtttgttaccgcgaaggtcacccaagaggtgctcgatcgcaaccgc
catgccgccgccagattattcttaaaagacatagtcctgctggttggcgagctgtcgatg
gaagaagccaatgatgagttaaaggcttacaccaacaacagctgcgagccataccgccac
gtgctgcgatctattcgtcaaagactgcgcgataccatagattatttgaatgcgcgcatc
gaaggccacaatcctgaagtcgataagtcgagcctgatttggcaagaaagcgatctcaaa
gcaccgttagaaatgctttataagagtttgaccgactgcggtatgcgcttaattgccaac
ggtttattgctcgacattctccgccgtctcgcctgttttggcattcatatgctcagactc
gacattcgccaagacgccagccgtcacagcgatgtgctcgccgagttaactcgctatctc
ggcatgggtgatttcaaccattgggatgaaaccgagaagcaagccttcctattacgtgaa
ctcagcaaccgtcgtccactgatcccaagtaactggcaaccctcagccgatgtggccgaa
gtgcttaatacctgtcgtttgattgctaaacatccagcaaaagcactcggatcctatgtg
atttcgatggcgggtaaaccatcggatgtcttaacggttttactcttgctcaaagaaacg
ggctgttcgcacccaatgcgcgtggtaccgctgtttgaaaccttaagcgacttaaacaac
gccgcggcctgtattaccgatttgctcgatatcgactggtatcgtggctataccaaaggc
atgcaagaggtcatgattggttactctgactctgccaaagatgctggtgtcatggcggcg
gcttgggctcagtatcacgcacaagagcagttagtggcggtctgtaaacaagcgggcgtc
aagctcacattattccatggccgtggtggcagcattggtcgcgggggtggtcctgcacac
aaagcaatcctatcgcaaccaccaggttcggtagatggccgcattcgtgtgactgagcag
ggcgaaatgatccgcttcaagtttggcttgccaaaactcgcggttcaaagcttggccctg
tatacctcggccgtattggaagcaaccctattaccaccgccagagccgaagcaagaatgg
cgcaattgcatgcaacgtatcgcagaagaatcagtgggtgcttaccgtggcatagtgcgt
gatgaacctgattttgtggcttatttccgcgcggcaacgccagaagtggaattaggaaaa
ctgccacttggcagccgcccagctaaacgtcgtgtcgatggtgggattgaaagcctacgg
gccattccgtggatttttgcttggtcgcaaaaccgcttgatgttacctgcatggcttggc
gccggtgaagcacttcaagccgccagtgaacgcggtgaaatgggtttactgcaagatatg
gagcgggaatggcccttcttcagcactcgcatttcaatgctagaaatggtctacgccaag
gcggaacctaatttagcccgctactacgaaacctgtttagtaccgaaagacttgcatcat
ttaggcgaaaccttgcgccaacgcttagatctgggcattaaagtcgtgcttgaactgaca
aaatcagatagcttaatggcgcatacgccgtggaatcgcgagtcagtaaaactgcgaaat
ccgtatattgatccattaaacttcttacaaaccgagctattagcgcggacacgtaaggaa
acaacagaaactcccgcgtctgaacatgtgcagctagcgctaatgctgactattgcaggt
gtggcagcgggaatgagaaacactggttaa

DBGET integrated database retrieval system