KEGG   Shigella sp. PAMC 28760: A0259_04255Help
Entry
A0259_04255       CDS       T04390                                 

Definition
(GenBank) cell division protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00550  Peptidoglycan biosynthesis
shq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0259_04255
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    A0259_04255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shq01011]
    A0259_04255
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shq03036]
    A0259_04255
Enzymes [BR:shq01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A0259_04255
Peptidoglycan biosynthesis and degradation proteins [BR:shq01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   A0259_04255
Chromosome and associated proteins [BR:shq03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    A0259_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF1616
Motif
Other DBs
NCBI-ProteinID: AMR21895
UniProt: A0A142GZ37
LinkDB All DBs
Position
873569..875335
Genome map
AA seq 588 aa AA seqDB search
MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMR
SLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIP
LDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIG
FTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERL
QALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTIT
DVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSS
NVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYG
LMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGG
GVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKY
YGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggcgaaaacgcagaaaccaaaacgtcaggaagaacatgccaactttatc
agttggcgttttgcgttgttatgcggctgtattctcctggcgctggcttttctgctcgga
cgcgtagcgtggttacaagttatctccccggatatgctggtgaaagagggcgacatgcgt
tctcttcgcgttcagcaagtttccacctcccgcggcatgattactgaccgttctggtcgc
ccgttagcggtgagcgtgccggtaaaagcgatttgggctgacccgaaagaagtgcatgac
gctggcggtatcagcgtcggtgaccgctggaaggcgctggctaacgcgctcaatattccg
ctggatcagctttcagcccgcattaacgccaacccgaaagggcgctttatttatctggcg
cgtcaggtgaaccctgacatggcggactacatcaaaaaactgaaactgccggggattcat
ctgcgtgaagaatctcgccgttattatccatccggcgaagtgactgctcacctcattggc
tttactaacgtcgatagtcaagggattgagggcgttgagaagagtttcgataaatggctt
accgggcagccgggtgagcgcattgtgcgtaaagaccgctatggtcgcgtaattgaagat
atttcttctactgacagccaggctgcgcacaacctggcgctgagtattgatgaacgcctg
caggcgctggtttatcgcgaactgaacaatgcggtggcctttaacaaggctgaatctggt
agcgccgtgctggtggatgtcaacaccggtgaagtgctggcgatggctaacagcccgtca
tacaaccctaacaatctgagcggcacgccgaaagaggcgatgcgtaaccgtaccatcacc
gacgtgtttgaacctggctcaacggttaaaccgatggtggtgatgaccgcgttgcaacgt
ggcgtggtgcgggaaaactcggtactcaataccattccttatcgaattaacggccacgaa
atcaaagacgtggcacgctacagcgaattaaccctgaccggggtattacagaagtcgagt
aacgtcggtgtttccaagctggcgttagcgatgccgtcctcagcgttagtagatacttac
tcacgttttggactgggaaaagcgaccaatttggggttggtcggagaacgcagtggctta
tatcctcaaaaacaacggtggtctgacatagagagggccaccttctctttcggctacggg
ctaatggtaacaccgttacagttagcgcgagtctacgcaactatcggcagctacggcatt
tatcgcccactgtcgattaccaaagttgaccccccggttcccggtgaacgtgtcttcccg
gaatccattgtccgcaccgtggtgcatatgatggaaagcgtggcgctaccgggcggcggc
ggcgtgaaggcggcgattaaaggctatcgtatcgccattaaaaccggtaccgcgaaaaag
gtcgggccggacggtcgctacatcaataaatatattgcttataccgcaggcgttgcgcct
gcgagtcagccgcgcttcgcgctggttgttgttatcaacgatccgcaggcgggtaaatac
tacggcggcgccgtttccgcgccggtctttggtgccatcatgggcggcgtattgcgtacc
atgaacatcgagccggatgcgctgacaacgggcgataaaaatgaatttgtgattaatcaa
ggcgaggggacaggtggcagatcgtaa

DBGET integrated database retrieval system