KEGG   Shigella sp. PAMC 28760: A0259_04295Help
Entry
A0259_04295       CDS       T04390                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00473  D-Alanine metabolism
shq00550  Peptidoglycan biosynthesis
shq01100  Metabolic pathways
shq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0259_04295 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0259_04295 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0259_04295 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:shq01011]
    A0259_04295 (ddl)
Enzymes [BR:shq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A0259_04295 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:shq01011]
 Precursor biosynthesis
  Amino acid ligase
   A0259_04295 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_ST GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: AMR21903
UniProt: A0A142GZ45
LinkDB All DBs
Position
884389..885309
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRA
EFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIE
KWLSGPEFTVAILDEEILPSIRIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQAL
VLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaatcgcggtcctgttgggcgggacttccgctgagcgggaagtttctctg
aattctggcgcagcggtgttagccgggctgcgtgaaggcggtattgatgcgtatcctgtc
gacccgaaagaagtcgacgtgacgcaactgaagtcgatgggttttcagaaagtgtttatc
gcgctacacggtcgcggcggtgaagatggtacgctgcagggcatgctcgagctgatgggc
ttgccttataccggcagcggagtgatggcatctgcgctttcaatggataaactacgcagc
aaactgctgtggcaaggtgccggtttaccggtcgcgccgtgggtagcgttaacccgcgca
gagtttgaaaaaggcctgagcgataagcagttagcagaaatttctgctctgggtttgccg
gttatcgttaagccgagccgcgaaggttccagtgtgggaatgtcaaaagtagtagcagaa
aatgctctacaagatgcattaagattggcatttcagcacgatgaagaagtattgattgaa
aaatggctaagtgggccggagttcacggttgcgatactcgatgaagaaattttaccgtca
atacgtattcaaccgtccggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccccgcaggtctggaagcgtcacaagaggccaatttgcaggcatta
gtgctgaaagcatggacgacgttaggttgcaaaggatggggacgtattgacgttatgctg
gacagcgatggacagttttatctgctggaagccaatacctcaccgggtatgaccagccac
agcctggtgccgatggcggcacgtcaggcaggtatgagcttctcgcagttggtagtacga
attctggaactggcggactaa

DBGET integrated database retrieval system