KEGG   Shigella sp. PAMC 28760: A0259_05535Help
Entry
A0259_05535       CDS       T04390                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00473  D-Alanine metabolism
shq00550  Peptidoglycan biosynthesis
shq01100  Metabolic pathways
shq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0259_05535
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0259_05535
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A0259_05535
Enzymes [BR:shq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A0259_05535
Peptidoglycan biosynthesis and degradation proteins [BR:shq01011]
 Precursor biosynthesis
  Amino acid ligase
   A0259_05535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AMR22131
LinkDB All DBs
Position
complement(1144581..1145675)
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttgcgcccttcggcgaccagccttgcgcaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgtttgtaggttctgatgttctggcttcagcagcctgtatggat
aaagatgtcaccaaacgtctgctacgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgctaatcgtcacaacatcagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacagtacgcaattgccgtcgatctggcgttcgaattcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaacccgcaa
gccagcacctgtggcgagatcgtactcaccagcgacttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcgccagaaatcaacgat
aagatccgggcgattgccgttcaggcttatcaaacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagaaaacgaagtggtgatcaacgagatcaacacactgcct
ggcttcaccaacatcagtatgtatccgaagctgtggcaagccagcggtctgggttacacc
gatctgatcacgcgtttgattgagctggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system