KEGG   Shigella sp. PAMC 28760: A0259_05550Help
Entry
A0259_05550       CDS       T04390                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00730  Thiamine metabolism
shq00790  Folate biosynthesis
shq01100  Metabolic pathways
shq02020  Two-component system
Module
shq_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A0259_05550
   00790 Folate biosynthesis
    A0259_05550
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A0259_05550
Enzymes [BR:shq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A0259_05550
Exosome [BR:shq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A0259_05550
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shq00537]
 Enzymes
  A0259_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AMR22134
LinkDB All DBs
Position
1146499..1147914
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARAPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGRGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDAASLNAVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccgggcaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgcgctagaaaaaggcgggagaggatcgattaccgaacagctgcttaacgct
cgtgccgatgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatgctgcctcactgaatgcggtgacggaagcgaaccagcaaaaacccctgctaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggcaat
atcgacaagcccgcagttacctgtacgcctaatccgcaacgtaatgacagcgtaccgacc
ctggcgcagatgactgataaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcatcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgacgaagccgtacaacgggcgctggaattcgctaaaaag
gatggcaacacgctggtcatagtcaccgctgatcacgcccacgccagccagattgttgcg
ccggacaccaaagcgccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggtagtcagctgcgt
attgcggcgtatggcccacatgccgccaatgtcgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system