KEGG   Shigella sp. PAMC 28760: A0259_07325Help
Entry
A0259_07325       CDS       T04390                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00020  Citrate cycle (TCA cycle)
shq00190  Oxidative phosphorylation
shq00650  Butanoate metabolism
shq01100  Metabolic pathways
shq01110  Biosynthesis of secondary metabolites
shq01120  Microbial metabolism in diverse environments
shq01130  Biosynthesis of antibiotics
shq01200  Carbon metabolism
Module
shq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A0259_07325 (sdhB)
   00650 Butanoate metabolism
    A0259_07325 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A0259_07325 (sdhB)
Enzymes [BR:shq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A0259_07325 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A0259_07325 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AMR22457
LinkDB All DBs
Position
1496386..1497102
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETGSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgttgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactggcagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcagcgtaatgcgtaa

DBGET integrated database retrieval system