KEGG   Shigella sp. PAMC 28760: A0259_10275Help
Entry
A0259_10275       CDS       T04390                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A0259_10275
Enzymes [BR:shq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A0259_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD
Motif
Other DBs
NCBI-ProteinID: AMR22984
UniProt: A0A142H276
LinkDB All DBs
Position
2061445..2062062
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFDEIRSEHEQQAIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFIGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALQVGSLTAIQERHRHD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattccgcaatgaatgcgggtaagtctacagcattgttg
caatcttcatacaattaccaggaacgcggcatgcgcactgtcgtatatacggcagaaatt
gatgatcgctttggtgccgggaaagtcagttcgcgtataggtttgtcatcgcctgcaaaa
ttatttaaccaaaattcatcattatttgatgagattcgttcggaacatgaacagcaggca
attcattgcgtactggttgatgaatgccagtttttaaccagacaacaagtatatgaatta
tcggaggttgtcgatcaactcgatatacccgtactttgttatggtttacgtaccgatttt
cgaggtgaattatttattggcagccaatacttactggcatggtccgacaaactggttgaa
ttaaaaaccatctgtttttgtggccgtaaagcaagcatggtgctgcgtcttgatcaagca
ggcagaccttataacgaaggtgagcaggtggttattggtggtaatgaacgatacgtttct
gtatgccgtaaacactataaagaggcgttacaagtcggctcattaacggctattcaggaa
aggcatcgccacgattaa

DBGET integrated database retrieval system