KEGG   Shigella sp. PAMC 28760: A0259_12070
Entry
A0259_12070       CDS       T04390                                 

Definition
(GenBank) two-component sensor histidine kinase
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A0259_12070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shq01001]
    A0259_12070
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:shq02022]
    A0259_12070
Enzymes [BR:shq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     A0259_12070
Protein kinases [BR:shq01001]
 Histidine kinases
  OmpR family
   A0259_12070
Two-component system [BR:shq02022]
 OmpR family
  RstB-RstA
   A0259_12070
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: AMR23315
LinkDB
Position
2408206..2409507
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLMQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNKATLIVEDDGSG
IAPENREHIFEPFVRLDPSRGRSTGGCGLGLAIVHSIALAMGGTVNCGTSELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaattgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggttgggctggtgtacaaatttaccgccgaacgcgcgggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgtgagatccccccacac
gactggggtaagacgctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccactgagtaaataccatcttgatgatatttccatgcaccgactgcgtggcggcgaaatt
gtcgccctggacgatcagtacacgtttttgcagcgtatcccgcgcagccactacgtgctg
gcagttggtcctgttccttatctttattacctccatcaaatgcgattgctggatatcgcc
ctgatcgcttttattgctatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcaat
gaacgtatccactttgatgagggttcgagctttgaacgacttggcgtcgcatttaaccag
atggcggacaatatcaacgccttaattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgtgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccgactcgatcgcccacaaaacgagcttcatcttagcgaacca
gacctgccgttgtggctgtcaacgcatctggcagatattcaggcagtaacgcccgataaa
acggtacggataaaaacgctcatgcaaggccattatgcggcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcgctactgccattcaacggttgaa
accagcctgctactgtcggggaataaagcgacattaattgttgaggatgatggctcaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
ggtcgctcaaccggcggctgcgggctgggactggcaattgtccactctatagcactggca
atgggcggtacggttaattgtggcaccagcgaactgggtggtgcccgcttctcgtttagc
tggccgttatggcataacatcccgcaatttacctctgcttga

DBGET integrated database retrieval system