KEGG   Shigella sp. PAMC 28760: A0259_16905Help
Entry
A0259_16905       CDS       T04390                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00250  Alanine, aspartate and glutamate metabolism
shq00280  Valine, leucine and isoleucine degradation
shq00410  beta-Alanine metabolism
shq00640  Propanoate metabolism
shq00650  Butanoate metabolism
shq01100  Metabolic pathways
shq01120  Microbial metabolism in diverse environments
Module
shq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A0259_16905
   00650 Butanoate metabolism
    A0259_16905
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A0259_16905
   00280 Valine, leucine and isoleucine degradation
    A0259_16905
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A0259_16905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:shq01007]
    A0259_16905
Enzymes [BR:shq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A0259_16905
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     A0259_16905
Amino acid related enzymes [BR:shq01007]
 Aminotransferase (transaminase)
  Class III
   A0259_16905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMR24204
UniProt: A0A142H5P6
LinkDB All DBs
Position
3412649..3413929
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAGIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggtgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacttgcatccg
aaagtggtggctgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgtcgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggtggtctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctaaaagacggattgttagcgatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgggatcgtggcgcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system