KEGG   Sarcophilus harrisii (Tasmanian devil): 100913262
Entry
100913262         CDS       T02286                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04261  Adrenergic signaling in cardiomyocytes
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04728  Dopaminergic synapse
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04920  Adipocytokine signaling pathway
shr04922  Glucagon signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100913262 (AKT3)
   04012 ErbB signaling pathway
    100913262 (AKT3)
   04014 Ras signaling pathway
    100913262 (AKT3)
   04015 Rap1 signaling pathway
    100913262 (AKT3)
   04370 VEGF signaling pathway
    100913262 (AKT3)
   04371 Apelin signaling pathway
    100913262 (AKT3)
   04630 JAK-STAT signaling pathway
    100913262 (AKT3)
   04668 TNF signaling pathway
    100913262 (AKT3)
   04066 HIF-1 signaling pathway
    100913262 (AKT3)
   04068 FoxO signaling pathway
    100913262 (AKT3)
   04072 Phospholipase D signaling pathway
    100913262 (AKT3)
   04071 Sphingolipid signaling pathway
    100913262 (AKT3)
   04024 cAMP signaling pathway
    100913262 (AKT3)
   04022 cGMP-PKG signaling pathway
    100913262 (AKT3)
   04151 PI3K-Akt signaling pathway
    100913262 (AKT3)
   04152 AMPK signaling pathway
    100913262 (AKT3)
   04150 mTOR signaling pathway
    100913262 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100913262 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100913262 (AKT3)
   04218 Cellular senescence
    100913262 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100913262 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100913262 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100913262 (AKT3)
   04620 Toll-like receptor signaling pathway
    100913262 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100913262 (AKT3)
   04660 T cell receptor signaling pathway
    100913262 (AKT3)
   04662 B cell receptor signaling pathway
    100913262 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100913262 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100913262 (AKT3)
   04062 Chemokine signaling pathway
    100913262 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100913262 (AKT3)
   04922 Glucagon signaling pathway
    100913262 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100913262 (AKT3)
   04920 Adipocytokine signaling pathway
    100913262 (AKT3)
   04929 GnRH secretion
    100913262 (AKT3)
   04915 Estrogen signaling pathway
    100913262 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100913262 (AKT3)
   04917 Prolactin signaling pathway
    100913262 (AKT3)
   04926 Relaxin signaling pathway
    100913262 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100913262 (AKT3)
   04919 Thyroid hormone signaling pathway
    100913262 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100913262 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100913262 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100913262 (AKT3)
   04728 Dopaminergic synapse
    100913262 (AKT3)
   04722 Neurotrophin signaling pathway
    100913262 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100913262 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100913262 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100913262 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913262 (AKT3)
   05205 Proteoglycans in cancer
    100913262 (AKT3)
   05230 Central carbon metabolism in cancer
    100913262 (AKT3)
   05231 Choline metabolism in cancer
    100913262 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100913262 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100913262 (AKT3)
   05212 Pancreatic cancer
    100913262 (AKT3)
   05225 Hepatocellular carcinoma
    100913262 (AKT3)
   05226 Gastric cancer
    100913262 (AKT3)
   05214 Glioma
    100913262 (AKT3)
   05221 Acute myeloid leukemia
    100913262 (AKT3)
   05220 Chronic myeloid leukemia
    100913262 (AKT3)
   05218 Melanoma
    100913262 (AKT3)
   05211 Renal cell carcinoma
    100913262 (AKT3)
   05215 Prostate cancer
    100913262 (AKT3)
   05213 Endometrial cancer
    100913262 (AKT3)
   05224 Breast cancer
    100913262 (AKT3)
   05222 Small cell lung cancer
    100913262 (AKT3)
   05223 Non-small cell lung cancer
    100913262 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100913262 (AKT3)
   05017 Spinocerebellar ataxia
    100913262 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100913262 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100913262 (AKT3)
   04931 Insulin resistance
    100913262 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913262 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100913262 (AKT3)
   05135 Yersinia infection
    100913262 (AKT3)
   05152 Tuberculosis
    100913262 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100913262 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100913262 (AKT3)
   05161 Hepatitis B
    100913262 (AKT3)
   05160 Hepatitis C
    100913262 (AKT3)
   05164 Influenza A
    100913262 (AKT3)
   05162 Measles
    100913262 (AKT3)
   05168 Herpes simplex virus 1 infection
    100913262 (AKT3)
   05163 Human cytomegalovirus infection
    100913262 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100913262 (AKT3)
   05169 Epstein-Barr virus infection
    100913262 (AKT3)
   05165 Human papillomavirus infection
    100913262 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100913262 (AKT3)
   05142 Chagas disease
    100913262 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100913262 (AKT3)
   01524 Platinum drug resistance
    100913262 (AKT3)
   01522 Endocrine resistance
    100913262 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100913262 (AKT3)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100913262 (AKT3)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100913262 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 100913262
NCBI-ProteinID: XP_031824554
LinkDB
Position
4
AA seq 539 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERSLAFFFFFLSWGGVSFNPQVGNFYL
YTFTPINILLQSCHLFLCVLFFNHDRGKVGETLKMSTPSLTKQKANFSRHIYKKRTFKNI
LQFHDNSMNHSLLIFHFSFVRFQTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaggag
aaacctcaagatgtggatttaccttatccccttaacaacttttcagtggcaaaatgccag
ctcatgaaaacagaacgaccaaagccaaacacatttattatcagatgcctccagtggacc
actgttatagaacgaacatttcatgtggatactccagaggaaaggtcacttgcttttttt
tttttttttttaagttggggaggggtatcattcaatccacaagtaggtaatttttacctt
tacacctttacacctataaacatacttttgcagagttgtcatttgtttctttgtgttctt
tttttcaatcatgatagaggtaaagtgggagaaactcttaagatgtctactcctagcctc
accaaacagaaggcgaacttctccagacatatctataaaaagagaacttttaaaaatata
cttcaattccatgataattctatgaaccattcattactcatttttcatttttcatttgtc
cgtttccagacaatgaatgactttgactatttgaaactattgggtaaaggcacttttggg
aaagtgattttggttcgagagaaggcaagtggaaaatattatgctatgaagattttgaag
aaagaagtaattattgcaaaggatgaagtggcgcatactctaacagaaagtagagtatta
aaaaacactagacacccatttttaacatccttgaaatattccttccagacaaaagatcgt
ttgtgttttgtgatggagtatgttaatggaggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgcttctatggtgcagaaattgtctccgctttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggaaaatttgatgttggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggattacagatgca
gctacgatgaagacgttttgtggtacacctgaataccttgcacctgaggtcttagaagac
aatgactatggccgtgcagtagactggtggggtctgggcgttgtcatgtatgaaatgatg
tgtgggagattgccgttctataaccaggatcatgagaagctttttgagctaatattaatg
gaggacattaaatttcctcgaactctttcttctgatgcaaaatccttactttcaggactc
ttaataaaagatccaaataaacgccttggtggaggtccagatgatgcaaaagaaattatg
aggcatagtttctttgttggtgtaaactggcaagatgtgtatgataaaaagctggtacct
ccttttaaacctcaagtaacatctgagacagacaccagatattttgatgaagaatttaca
gctcagacaattacaataacaccgcctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagagacggccacatttcccacagttttcctactcagcaagtggacgagaataa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100917987
Entry
100917987         CDS       T02286                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04261  Adrenergic signaling in cardiomyocytes
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04728  Dopaminergic synapse
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04920  Adipocytokine signaling pathway
shr04922  Glucagon signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100917987 (AKT1)
   04012 ErbB signaling pathway
    100917987 (AKT1)
   04014 Ras signaling pathway
    100917987 (AKT1)
   04015 Rap1 signaling pathway
    100917987 (AKT1)
   04370 VEGF signaling pathway
    100917987 (AKT1)
   04371 Apelin signaling pathway
    100917987 (AKT1)
   04630 JAK-STAT signaling pathway
    100917987 (AKT1)
   04668 TNF signaling pathway
    100917987 (AKT1)
   04066 HIF-1 signaling pathway
    100917987 (AKT1)
   04068 FoxO signaling pathway
    100917987 (AKT1)
   04072 Phospholipase D signaling pathway
    100917987 (AKT1)
   04071 Sphingolipid signaling pathway
    100917987 (AKT1)
   04024 cAMP signaling pathway
    100917987 (AKT1)
   04022 cGMP-PKG signaling pathway
    100917987 (AKT1)
   04151 PI3K-Akt signaling pathway
    100917987 (AKT1)
   04152 AMPK signaling pathway
    100917987 (AKT1)
   04150 mTOR signaling pathway
    100917987 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100917987 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100917987 (AKT1)
   04218 Cellular senescence
    100917987 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917987 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100917987 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100917987 (AKT1)
   04620 Toll-like receptor signaling pathway
    100917987 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100917987 (AKT1)
   04660 T cell receptor signaling pathway
    100917987 (AKT1)
   04662 B cell receptor signaling pathway
    100917987 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100917987 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100917987 (AKT1)
   04062 Chemokine signaling pathway
    100917987 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100917987 (AKT1)
   04922 Glucagon signaling pathway
    100917987 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100917987 (AKT1)
   04920 Adipocytokine signaling pathway
    100917987 (AKT1)
   04929 GnRH secretion
    100917987 (AKT1)
   04915 Estrogen signaling pathway
    100917987 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100917987 (AKT1)
   04917 Prolactin signaling pathway
    100917987 (AKT1)
   04926 Relaxin signaling pathway
    100917987 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100917987 (AKT1)
   04919 Thyroid hormone signaling pathway
    100917987 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100917987 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100917987 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100917987 (AKT1)
   04728 Dopaminergic synapse
    100917987 (AKT1)
   04722 Neurotrophin signaling pathway
    100917987 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100917987 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100917987 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100917987 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917987 (AKT1)
   05205 Proteoglycans in cancer
    100917987 (AKT1)
   05230 Central carbon metabolism in cancer
    100917987 (AKT1)
   05231 Choline metabolism in cancer
    100917987 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100917987 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100917987 (AKT1)
   05212 Pancreatic cancer
    100917987 (AKT1)
   05225 Hepatocellular carcinoma
    100917987 (AKT1)
   05226 Gastric cancer
    100917987 (AKT1)
   05214 Glioma
    100917987 (AKT1)
   05221 Acute myeloid leukemia
    100917987 (AKT1)
   05220 Chronic myeloid leukemia
    100917987 (AKT1)
   05218 Melanoma
    100917987 (AKT1)
   05211 Renal cell carcinoma
    100917987 (AKT1)
   05215 Prostate cancer
    100917987 (AKT1)
   05213 Endometrial cancer
    100917987 (AKT1)
   05224 Breast cancer
    100917987 (AKT1)
   05222 Small cell lung cancer
    100917987 (AKT1)
   05223 Non-small cell lung cancer
    100917987 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100917987 (AKT1)
   05017 Spinocerebellar ataxia
    100917987 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100917987 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100917987 (AKT1)
   04931 Insulin resistance
    100917987 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100917987 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100917987 (AKT1)
   05135 Yersinia infection
    100917987 (AKT1)
   05152 Tuberculosis
    100917987 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100917987 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100917987 (AKT1)
   05161 Hepatitis B
    100917987 (AKT1)
   05160 Hepatitis C
    100917987 (AKT1)
   05164 Influenza A
    100917987 (AKT1)
   05162 Measles
    100917987 (AKT1)
   05168 Herpes simplex virus 1 infection
    100917987 (AKT1)
   05163 Human cytomegalovirus infection
    100917987 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100917987 (AKT1)
   05169 Epstein-Barr virus infection
    100917987 (AKT1)
   05165 Human papillomavirus infection
    100917987 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100917987 (AKT1)
   05142 Chagas disease
    100917987 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100917987 (AKT1)
   01524 Platinum drug resistance
    100917987 (AKT1)
   01522 Endocrine resistance
    100917987 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100917987 (AKT1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100917987 (AKT1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100917987 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100917987
NCBI-ProteinID: XP_031808997
Ensembl: ENSSHAG00000008957
LinkDB
Position
2
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQMVADSLKKQEEELMDF
RSGSPSDNSGAEEMEVSTTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPDAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFAGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDNERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtcgcgattgtgaaggagggctggctgcataagcgaggagaatatatcaaa
acgtggcggccacgctacttcttgctaaagagtgatgggaccttcattggctataaggag
cggccacaagatgtggaccagcgggaatctcccctcaacaatttctcagttgcacaatgc
cagctgatgaagacagagcgacccaaacccaatacattcatcatccgctgcctgcagtgg
accacggtaattgagagaacgtttcacgtggagacccccgaggagcgggaagaatggacc
aaagccatccagatggtggctgacagcctaaaaaagcaggaggaagaactcatggacttc
cgatcaggctcacccagtgacaattctggggctgaggagatggaggtgtctacaacaaag
cccaaacacaaagtgacaatgaatgagttcgagtacctgaagctgttgggcaaaggcaca
tttgggaaggtgatcctagtgaaggagaaggcaactgggcgatattatgccatgaagatc
ctcaagaaggaagtgattgtggccaaggatgaggtggctcatacacttacggagaatcga
gtcttacagaactccaggcacccattcctgacagcactgaagtactcgttccagacgcat
gaccgcctgtgctttgtgatggagtatgccaatggaggagagctatttttccatctctct
cgagaacgggtattctccgaagacagagccaggttctatggggcagagatcgtgtctgcg
ctggactacttgcattctgagaagaatgtggtatacagagacctcaagttggaaaaccta
atgctggacaaagatggtcacataaaaatcactgacttcggtctgtgcaaggaggggatc
aaggatggtgctacaatgaagaccttctgcgggactccagaatatctggcccctgaggtg
ctagaggacaatgactatggccgggcagtggactggtggggcctgggagtggtcatgtat
gagatgatgtgcggccggctgcccttctacaaccaggatcatgagaagctgtttgagctg
atcctcatggaggagatccgatttcctcgaacgctgtccccggacgccaagtcacttttg
tcagggttgctgaaaaaggaccccaagcagaggttaggtgggggaccagatgatgcaaaa
gagattatgcagcacaagttttttgctggcattgtatggcaagatgtctatgaaaaaaag
ctggtgcctccgtttaagccacaggtcacatctgagacggacacccggtattttgatgag
gagtttacagcccagatgatcacaatcacccctcctgaccaagatgacaacatggaatgt
gtggataacgagagacggccccattttcctcagttctcgtactctgctagtgggacagct
tga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100925440
Entry
100925440         CDS       T02286                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04210  Apoptosis
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04261  Adrenergic signaling in cardiomyocytes
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04611  Platelet activation
shr04620  Toll-like receptor signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04668  TNF signaling pathway
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04728  Dopaminergic synapse
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04920  Adipocytokine signaling pathway
shr04922  Glucagon signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr04926  Relaxin signaling pathway
shr04929  GnRH secretion
shr04931  Insulin resistance
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr04973  Carbohydrate digestion and absorption
shr05010  Alzheimer disease
shr05017  Spinocerebellar ataxia
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100925440 (AKT2)
   04012 ErbB signaling pathway
    100925440 (AKT2)
   04014 Ras signaling pathway
    100925440 (AKT2)
   04015 Rap1 signaling pathway
    100925440 (AKT2)
   04370 VEGF signaling pathway
    100925440 (AKT2)
   04371 Apelin signaling pathway
    100925440 (AKT2)
   04630 JAK-STAT signaling pathway
    100925440 (AKT2)
   04668 TNF signaling pathway
    100925440 (AKT2)
   04066 HIF-1 signaling pathway
    100925440 (AKT2)
   04068 FoxO signaling pathway
    100925440 (AKT2)
   04072 Phospholipase D signaling pathway
    100925440 (AKT2)
   04071 Sphingolipid signaling pathway
    100925440 (AKT2)
   04024 cAMP signaling pathway
    100925440 (AKT2)
   04022 cGMP-PKG signaling pathway
    100925440 (AKT2)
   04151 PI3K-Akt signaling pathway
    100925440 (AKT2)
   04152 AMPK signaling pathway
    100925440 (AKT2)
   04150 mTOR signaling pathway
    100925440 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100925440 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100925440 (AKT2)
   04218 Cellular senescence
    100925440 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100925440 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100925440 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100925440 (AKT2)
   04620 Toll-like receptor signaling pathway
    100925440 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100925440 (AKT2)
   04660 T cell receptor signaling pathway
    100925440 (AKT2)
   04662 B cell receptor signaling pathway
    100925440 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100925440 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100925440 (AKT2)
   04062 Chemokine signaling pathway
    100925440 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100925440 (AKT2)
   04922 Glucagon signaling pathway
    100925440 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100925440 (AKT2)
   04920 Adipocytokine signaling pathway
    100925440 (AKT2)
   04929 GnRH secretion
    100925440 (AKT2)
   04915 Estrogen signaling pathway
    100925440 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100925440 (AKT2)
   04917 Prolactin signaling pathway
    100925440 (AKT2)
   04926 Relaxin signaling pathway
    100925440 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100925440 (AKT2)
   04919 Thyroid hormone signaling pathway
    100925440 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100925440 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100925440 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100925440 (AKT2)
   04728 Dopaminergic synapse
    100925440 (AKT2)
   04722 Neurotrophin signaling pathway
    100925440 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100925440 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100925440 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100925440 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100925440 (AKT2)
   05205 Proteoglycans in cancer
    100925440 (AKT2)
   05230 Central carbon metabolism in cancer
    100925440 (AKT2)
   05231 Choline metabolism in cancer
    100925440 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100925440 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100925440 (AKT2)
   05212 Pancreatic cancer
    100925440 (AKT2)
   05225 Hepatocellular carcinoma
    100925440 (AKT2)
   05226 Gastric cancer
    100925440 (AKT2)
   05214 Glioma
    100925440 (AKT2)
   05221 Acute myeloid leukemia
    100925440 (AKT2)
   05220 Chronic myeloid leukemia
    100925440 (AKT2)
   05218 Melanoma
    100925440 (AKT2)
   05211 Renal cell carcinoma
    100925440 (AKT2)
   05215 Prostate cancer
    100925440 (AKT2)
   05213 Endometrial cancer
    100925440 (AKT2)
   05224 Breast cancer
    100925440 (AKT2)
   05222 Small cell lung cancer
    100925440 (AKT2)
   05223 Non-small cell lung cancer
    100925440 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100925440 (AKT2)
   05017 Spinocerebellar ataxia
    100925440 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100925440 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100925440 (AKT2)
   04931 Insulin resistance
    100925440 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100925440 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100925440 (AKT2)
   05135 Yersinia infection
    100925440 (AKT2)
   05152 Tuberculosis
    100925440 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100925440 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100925440 (AKT2)
   05161 Hepatitis B
    100925440 (AKT2)
   05160 Hepatitis C
    100925440 (AKT2)
   05164 Influenza A
    100925440 (AKT2)
   05162 Measles
    100925440 (AKT2)
   05168 Herpes simplex virus 1 infection
    100925440 (AKT2)
   05163 Human cytomegalovirus infection
    100925440 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100925440 (AKT2)
   05169 Epstein-Barr virus infection
    100925440 (AKT2)
   05165 Human papillomavirus infection
    100925440 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100925440 (AKT2)
   05142 Chagas disease
    100925440 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100925440 (AKT2)
   01524 Platinum drug resistance
    100925440 (AKT2)
   01522 Endocrine resistance
    100925440 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100925440 (AKT2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100925440 (AKT2)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100925440 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like PH
Other DBs
NCBI-GeneID: 100925440
NCBI-ProteinID: XP_031817487
LinkDB
Position
3
AA seq 654 aa
MNEVSVVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEVPDQTLPPLNNFSVGVC
WFRALAGARLWSRSLSGSAGPRWSHARHAGSTETVQSVGFSRTGSVIAVEPAPSAVPGTA
IVGNEGAATLGGGLEPRLALFINSQDSGTSLGFCGRAGDDLGSHLAGHSSWRLRGGLHAA
CDRSKPPARAVGSPGLRGPILGLEGTHSDFRRGRLLAAGESGEGGGKAESRRGGQSHKAW
RWECEGDGIRRQERPALLTARGPLSVLLREEWMRAIQMVANSLKNQEPVEDSMDYKCGSP
SDPSVAEEMEVAVSKTRTKATMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEV
IIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYANGGELFFHLSRERVF
TEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGITDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMTCGRLPFYNQDHERLFELILMEEI
RFPRTLSPEAKSLLAGLLKKDPKQRLGGGPRDAKEVMEHRFFSAINWQDVLQKKLLPPFK
PQVTSEIDTRYFDDEFTAQSITITPPDRYDSMGSLEPDQRTHFPQFSYSASIRE
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtccgtcgtcaaagaaggctggctccacaagagaggtgaatacatcaag
acctggcgacctcggtacttcctgttaaaaagtgatgggtccttcattgggtacaaagag
aggccggaggtccctgaccagactctgccccccttaaataacttttctgtaggagtttgt
tggtttagagccctcgcgggggcccgtctatggagccgttccctttctggctcggccggc
cctcgttggtcccatgcccgacatgcgggttccacagagactgtccagagtgttggcttc
tcgcggacagggagtgtcattgctgtggagccggcgcctagtgcagtgcctggcacagcc
atcgtgggcaatgaaggggcggccaccctgggagggggcctggagcccaggctggccctc
ttcataaatagtcaggactcgggcacttcccttggcttctgtggaagggctggagatgac
ctggggtctcatttggctgggcactcctcgtggcggctccgaggcggcctgcatgcagcg
tgtgaccgctccaagccaccggctcgggccgtgggcagccctggcctcagagggccaatc
cttggcctagagggcacacacagtgatttcaggagagggaggctgctggccgccggggag
tctggggagggtggaggcaaggcagagagcaggcgtgggggacagtcacacaaagcgtgg
aggtgggagtgtgagggggacgggatccgcaggcaggagaggccagccctgctcacggcc
cgggggcctctgtctgtgctgctcagggaggagtggatgagggccatccagatggtggcc
aacagcctgaagaaccaggagcctgtggaagactcgatggactacaaatgtggctcccct
agcgacccctcggtggctgaggagatggaagtggctgtcagcaaaacgcggacgaaggcg
accatgaacgactttgattatctcaagcttctgggcaaaggcacctttggcaaagtcatc
ctggtgcgggaaaaggccacggggcgctactatgccatgaagatcctgaggaaggaggtc
atcatcgccaaggatgaagttgcccacacggtcaccgagagtcgagtcctacagaacacc
aggcacccatttctcacagcactaaagtacgcctttcagacgaacgaccgcctgtgtttt
gtgatggaatatgccaacggtggggagctcttcttccacctgtcgagagagcgtgtcttc
acagaggacagagcgcggttctatggggccgagatcgtctctgccttggagtacttgcac
tccagggacgtggtctaccgcgacatcaagctggagaacctcatgctggacaaagatggg
cacatcaagatcaccgactttggcctctgcaaggagggcatcacggacggggccaccatg
aagaccttctgcggcaccccggagtacctggcccctgaggtgctggaggacaacgactat
gggcgggccgtagactggtgggggctgggcgtggtgatgtacgagatgacctgtggccgg
ctgcccttctacaaccaggaccatgagcgcctctttgagctgatcctcatggaggagatc
cgcttccctcgcacgctgagccctgaggccaaatccctgctggctgggctcctgaaaaag
gaccccaagcagaggctgggcggggggccccgggacgccaaggaggtcatggagcaccgc
ttcttctccgccatcaattggcaggacgtcctacagaagaagcttctgcccccgtttaag
ccccaggttacgtcagagattgacacacggtactttgatgatgagttcacggcacagtcc
atcactatcacccccccagaccgatatgacagcatgggctccctggagcccgaccagcgc
acccacttcccacagttctcctactcggccagcatccgggagtga

DBGET integrated database retrieval system