KEGG   Sarcophilus harrisii (Tasmanian devil): 100913363Help
Entry
100913363         CDS       T02286                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01100  Metabolic pathways
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100913363
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100913363
   00982 Drug metabolism - cytochrome P450
    100913363
   00983 Drug metabolism - other enzymes
    100913363
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913363
   05204 Chemical carcinogenesis
    100913363
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100913363
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100913363
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100913363
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shr02000]
    100913363
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100913363
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100913363
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 100913363
NCBI-ProteinID: XP_003755449
Ensembl: ENSSHAG00000016857
LinkDB All DBs
Position
1
AA seq 241 aa AA seqDB search
MSQNSSRSLGKGSSPPGPVPAGIIRVYSMRFCPFAQRTLLVLKAKGIKHEIININLKNKP
DWFFNKNPFGLVPVLETSQGQLIYESVITCEYLDEAYPGKLFPEDPYKKAFQKMILESFS
KVPLLSKESLVAVRNGEDCSAQKAELRMVFSNLEEILFRQKTTFFGGDTVSMIDYLIWPW
FERLGSFEIADCVNHTLKLKLWIAAMKKDPTVSALLVEEKTLKNFIHLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaaactcaagtaggagcctggggaaaggaagctctcccccgggtcctgtacca
gctggaatcatccgtgtttacagcatgagattctgtccctttgctcagagaactctgctt
gtcctgaaggccaaaggaatcaagcatgaaattatcaacatcaatctgaaaaacaaacct
gattggttctttaataagaatccctttggtctagtaccagttctggagaccagtcagggt
caactaatctatgaatctgttatcacttgtgagtacttagatgaagcctatccagggaag
ttgtttccagaagatccctataagaaagcttttcaaaagatgattttggagtcgttctct
aaggtaccacttttgtctaaggaatctttggtagctgtaaggaatggagaagattgctct
gctcagaaagcagaactccgtatggtgttcagcaatctggaggagattctttttcgtcag
aagacaactttctttggtggcgacactgtatccatgatcgattacctcatttggccctgg
tttgaacgtctgggatcatttgagatagcagactgtgtgaaccacaccttgaaacttaag
ctctggatagcagccatgaagaaggatcctacagtatcagccctccttgtagaagagaaa
actcttaaaaatttcatacatctctatctgcagaatagtcctgaggcctgtgattatggt
ctatga

DBGET integrated database retrieval system