KEGG   Sarcophilus harrisii (Tasmanian devil): 100913437
Entry
100913437         CDS       T02286                                 

Gene name
NOS3
Definition
(RefSeq) nitric oxide synthase, endothelial
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00220  Arginine biosynthesis
shr00330  Arginine and proline metabolism
shr01100  Metabolic pathways
shr04020  Calcium signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04066  HIF-1 signaling pathway
shr04071  Sphingolipid signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04611  Platelet activation
shr04915  Estrogen signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04931  Insulin resistance
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100913437 (NOS3)
   00330 Arginine and proline metabolism
    100913437 (NOS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100913437 (NOS3)
   04371 Apelin signaling pathway
    100913437 (NOS3)
   04066 HIF-1 signaling pathway
    100913437 (NOS3)
   04020 Calcium signaling pathway
    100913437 (NOS3)
   04071 Sphingolipid signaling pathway
    100913437 (NOS3)
   04022 cGMP-PKG signaling pathway
    100913437 (NOS3)
   04151 PI3K-Akt signaling pathway
    100913437 (NOS3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100913437 (NOS3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100913437 (NOS3)
   04921 Oxytocin signaling pathway
    100913437 (NOS3)
   04926 Relaxin signaling pathway
    100913437 (NOS3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100913437 (NOS3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100913437 (NOS3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100913437 (NOS3)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100913437 (NOS3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 100913437
NCBI-ProteinID: XP_031795271
Ensembl: ENSSHAG00000009161
LinkDB
Position
5
AA seq 1193 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCSKQSGSPGPENGGPAVADVSPPVARPPEGPKFSR
IKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPKQLQSRPTEGPPSPGQLLIQARDF
INQYYSSIKRSGSPAHGQRLREVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVGRIQW
GKLQVFDARDCSSAQEMFTYICNHIKYATNKGNLRSAITVFPQRSQGKGDFRIWNSQLIR
YAGYRQQDGSVLGDPANVEITELCIQHGWTPKNGRFDVLPLLLQASDEPPELFPLPPELV
LEVPLQHPTLEWFESLGLRWYALPAVSNMLLEIGGLEFPAVPFSGWYMSSEIGMRNLCDP
HRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINLAVLHSYQLAKVTIVDHHAATASFMKH
LENEQRARGGCPADWVWIVPPISGSLTPVFHQEMVNYFLSPAFHYQPDPWKGTATKGTGI
TRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRLFRKAFDPRV
LCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGERFAAALMEMSGPYNSSPRPEQHKSYK
IRFNSVSCSDTLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTR
LEELGGERLLQLGQGDELCGQEEAFQGWAQAAFQASCETFCVGDDAKAAARDIFSPKRSW
KRQRYRLSAQPEGLQLLPGLIHVHRRKMFPATVLSVENLQSSKSTRATILVRLATGGQEG
LQYQPGDHIGICPPNRPGLVEALLSRVEDPPLPSEPIAVEQLEKGSPGSPPPGWVRDPRL
PSCTLQQALTFFLDITSPPGPQLLRLLSTLAEEPSEQQELEALSKDARRYEEWKWFRCPT
LLEVLEQFPSVALPAPLLLTQLPLLQPRYYSVSSAPSAHPGEIHLTVAVLAYRTQDGLGP
LHYGVCSSWLSQLKAGDVVPCFIRGAPSFRLPSDPSVPCILVGPGTGIAPFRGFWQERLH
DLEHKGLRPAPMTLVFGCRCSQLDHLYREEVHEAQRRGVFGRVLTAFSREPDSPKTYVQD
VLRAELAPEVHRVLCLEGGHMFVCGDVTMATSVLQTVQRILATEGGMELSEAGDVIGVLR
DQQRYHEDIFGLTLRTQEVTNRIRTQSFSLQERQARSAVPWALADPTPETPES
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgggcaatttgaagagtgtgggtcaggagcccggaccaccctgcggactggggctggga
ctggggctgggactatgcagcaaacagagtgggagcccaggacctgagaatgggggtcca
gccgtggcggacgtcagccccccagtagcccggccaccggaggggcccaaattctccaga
ataaagaactgggaagtaggaagtatcacctacgacactctgagtgcccaagcccagcag
gatgggccctgtaccccaaggcgttgcctgggctcccttgtgtttccaaagcaactgcaa
agccgccccacggaggggcccccgtcccccggccagctactcatccaggcccgagatttc
attaaccaatactacagctctatcaagaggagcggctccccagcccatggacaacggctt
cgggaagtggaagctgaagtggcggccacaggcacctaccagctccgggagagtgagctt
gtatttggggctaagcaggcctggagaaatgcccctcggtgtgtgggcaggatacagtgg
ggaaagctgcaggtgtttgatgcccgagattgcagctctgctcaggagatgttcacctat
atctgcaatcacatcaaatatgctaccaacaaaggcaaccttcgctcagccatcacagtg
ttcccacagcgctcccaaggcaagggggacttccgtatctggaacagccagctgatccga
tacgcgggctaccggcagcaagatggctctgtcttgggggaccctgccaacgtggagatc
actgagctctgcatccagcatggctggacccccaagaacgggcgctttgatgtgctgccg
ctgctgctccaggcctctgatgagccgcctgaactcttccctctgcctcctgaacttgtg
ctcgaggtgccgttgcaacatcccacgctggagtggtttgagtccttgggccttcgctgg
tacgccctcccggctgtgtccaacatgctgctggagatcggggggctggagttccccgca
gtgcccttcagcggctggtacatgagcagtgagattgggatgcgcaacctgtgtgacccc
caccgctacaacatcctagaggacgtggccgtctgcatggacctggacacaaggacaacc
tcatctctgtggaaggacaaggcagcagtggagatcaacctggccgtgctgcacagctac
caactggccaaagtgaccatcgtggatcaccacgcggccacggcctccttcatgaagcac
ctggagaacgagcagcgggcgcggggcggctgccctgcagactgggtctggattgtccca
ccaatctccggcagcctcacccccgtctttcaccaggaaatggtcaactacttcctgtcg
cctgcgttccactaccagcctgatccatggaaggggacagcaacaaaaggaactggaatc
acccggaaaaaaacatttaaggaagtggccaacgcagtgaagatctcggcttccctgatg
ggcacagtgatggccaagcgggtgaaggcgacgattctgtacggctcagaaactggccgt
gcccaaagctacgctcagcagctggggaggctgttccggaaggccttcgatccccgggtc
ctctgcatggatgagtatgacgtagtgtccctggagcatgagaccctggtcctggtggta
actagcacattcgggaatggagaccctccagaaaatggagagagatttgcagccgccctg
atggaaatgtctggcccctacaacagctctcccagaccagagcagcacaaaagctacaag
attcgcttcaacagcgtctcctgctcagacacgctggtgtcctcgtggcggcggaagagg
aaggaatccagtaacaccgacagtgcgggagccttagggaccctgaggttctgtgtgttt
gggctcggctcccgtgcctacccccacttctgtgcttttgcccgggctgtggatacccgt
ctggaagagctggggggagagaggctactgcagctgggccagggggacgagttatgtggc
caggaagaggctttccagggctgggcccaagctgcattccaggcctcctgtgagaccttc
tgtgtgggggacgatgccaaagctgctgcccgggacatattcagccccaagagaagttgg
aaacgccaaagataccgcctgagtgcccagccagaggggctccagctgctgccgggcctg
atacatgtacacaggaggaagatgttcccagccaccgtcctctcggtggaaaacctacag
agcagcaagtcaactcgggccacaatcctggttcgtctggccacaggggggcaggagggc
ctgcagtatcagcctggcgaccacattgggatctgcccccccaaccggcctggcctggtg
gaggccctgttgagccgagtagaggatccacccctgcccagtgagcctattgctgtggag
cagctggagaaggggagcccaggcagcccacccccaggctgggtccgggacccccggctg
ccctcatgcacattacagcaggccctcacctttttcctggacatcacctcccccccgggg
cctcagctccttcgcctgctcagcaccctggcagaggagcccagcgagcagcaagagctg
gaggctctcagcaaggatgctcggcgctatgaggaatggaaatggttccgctgccccacg
cttctggaggtgctggagcagttcccgtcggtggccctgccagcgcctctgctcctcacc
cagctgcctctgctccagccacggtactactcagtcagctctgcccccagtgcccacccc
ggggagatccacctcacagtggctgtgctggcctacaggacccaggatgggctcggcccc
ctgcactatggggtctgctcctcgtggttaagtcagctcaaggctggagacgtagttccc
tgcttcatcaggggagctccatccttccggctgccgtccgaccccagcgtgccctgcatc
ctggtggggccgggcacgggcatcgcccccttccgcgggttttggcaggagcggctacac
gacctggagcacaaaggactgcgtcccgcccccatgaccctggtcttcgggtgccgctgc
tcccagctggaccacctgtaccgagaggaggtgcacgaggcgcagcgtcgaggggtcttc
ggccgcgtgctcacagccttttccagggagcccgacagccccaagacctacgtgcaggac
gtcctgcgggcagagctggcccccgaggtgcaccgcgtgctgtgcctcgagggcggccac
atgttcgtctgcggcgacgtcactatggcgaccagcgtgctgcagacggtgcagcggatc
ctggccacggagggcgggatggagttgagcgaggccggagacgtcatcggggtgctgcgg
gaccagcagcgctaccacgaggacatcttcgggctgacgctgcgcacgcaggaggtgacg
aaccgcattcgcacgcagagcttctccctgcaggagcggcaggcgcggagcgccgtgccc
tgggctctggccgatcccaccccggagaccccggagtcctga

DBGET integrated database retrieval system