KEGG   Sarcophilus harrisii (Tasmanian devil): 100913447Help
Entry
100913447         CDS       T02286                                 

Gene name
NSD2
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase NSD2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
shr05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100913447 (NSD2)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    100913447 (NSD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100913447 (NSD2)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100913447 (NSD2)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100913447 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 100913447
NCBI-ProteinID: XP_023361918
Ensembl: ENSSHAG00000006750
LinkDB All DBs
Position
6
AA seq 1366 aa AA seqDB search
MNSSIIRNSPSIIHKIVSQLKMKQVPEILGSTNGKTQNCEVNRECSVFLSKAQISTTLPE
GVMQKFNGHEALPFIPADKLKDLTSRVFNGESGAQDTKLRFESQEIKGIGTPPHTTPIKN
GSPEIKLKITKTYMNGKPLFESSICGDNGPDVSQSEENEQKLENKSRRNRKRSIKYDSLL
EQGLVEAALVSKASSPSEKKILAKRESYPNINKEKDHLLKYNVGDLVWSKVSGYPWWPCM
VSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVPFEGEEQFEKLCQESAK
QAPTKAEKIKLLKPISGKLRAQWEMGIIQAKEAVNMTVEERKDKFTFVYVRDRLHLNPQV
AKEAGIAVDPLEEVDESSDVSEETAQNPKYKELGVPNKRRRRSKLPTCPDNQESDSGTKN
ITPQRAAEQVDSKRGLGSPVGRKKAAASTPRSRKGDSGSQFLVFCQKHRDEVVAEHPDAS
SEEIEELLESQWNMLNEKQKARYNTKFAIVTSPKSEEDSGNLHGKKRNHTKRTQHPTEDF
EVQEPARKRLRMDKHNNRKRETSSDKTAKTNSSKVTETSSSLKNQSATKNLSDACKPLKK
RNRASAAESSTLAFSKSSSPSTSLTENEISDGQGDEPSESPYESADETQTEISISSKKSE
RGTTAKREYVCQLCEKSGNLLLCEGPCYGAFHLSCLGLSRRPEGKFICSECTSGIHSCFV
CKEKKTEVKRCVVSQCGKFYHEACVKKYHLTVFESRGFRCPLHSCVSCHVTNPSNPRSSK
GKMMRCVRCPVAYHGGDGCLAAGCSVIASNNIICTNHFTARKGKSHHAHVNVSWCFVCSK
GGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVC
HPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGIKGIGKVFK
NALQEAEARFREIKLQREARETQENERKPPPYKHIKVNKPCGKVQIYTADISEIPKCNCK
PTDENPCGFDSECLNRMLMYECHPQVCPAGEQCQNQCFTKRQYPETKIIKTDGKGWGLVA
KRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRF
MNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCS
GFLGDRPKNSAALSSEEKGKKTKKKTRRRRTKGEGKKESEDDCFRCGDGGQLVLCDRKCC
TKAYHLSCLDLVKRPFGKWECPWHHCDVCGKPSVSFCHFCPNSFCKDHQDGTVFSTTQDG
RLRCSEHEFGVESIRNPKTEKPFPEPTKLKPKRKKRRCWRRKTEYK
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atgaactctagtattataagaaattctccatcaataattcataaaattgtaagtcagctg
aaaatgaagcaagttccagagatccttggaagtaccaatgggaagactcaaaattgtgaa
gttaatcgggaatgttcagtgttcctcagcaaagcccagatttctacaaccctaccagag
ggtgtcatgcaaaaatttaatggccatgaagcgctaccattcattcctgctgataaattg
aaagatctgacctcccgagtcttcaatggagagtctggtgcccaagataccaagctgcgc
tttgaatcccaggaaataaagggaattggaacaccccctcatactactcctatcaaaaat
ggctctcctgagattaaactgaaaatcaccaaaacatacatgaatggaaaacctcttttt
gaatcttctatttgtggagacaatggtccagatgtgtcccaatcagaagaaaatgaacaa
aaactagaaaacaagtcaagaaggaataggaaaaggagcataaagtatgattccttactt
gaacagggccttgttgaagcagctttggtatctaaggcttcaagtccctcggaaaaaaag
attttagctaagagagagtcatatccaaacatcaataaagaaaaagaccatctgttgaag
tataatgttggagatttggtatggtcaaaagtttcaggttatccttggtggccatgtatg
gtttcagcagatcctctccttcacagctataccaaactaaaaggacagaaaaagagtgct
cgtcaatatcatgtacagttctttggtgatgctccagaaagagcttggatatttgagaag
agtcttgtaccatttgaaggagaagagcagtttgaaaaattatgtcaggaaagtgcaaaa
caggcacccacaaaagctgagaagatcaagctattgaaacctatttcaggaaaattgagg
gcccaatgggaaatgggcattattcaagcaaaagaagcagtgaatatgacagtagaagag
cggaaagacaagtttaccttcgtttatgttagggaccgacttcatctaaatcctcaagta
gctaaagaagctggtattgcagtggacccattagaggaagtagatgaatcttcagatgta
agtgaagaaaccgcacaaaacccaaagtataaagaattaggtgtccccaacaagaggagg
aggagatcaaaattaccaacttgtcctgataatcaggaaagtgattcagggaccaaaaac
attactcctcaaagggcagctgaacaagtagattcaaaaagaggattgggctctcctgtt
ggtagaaagaaggctgcggcatctactccacgaagcagaaagggagattcagggtctcaa
tttttggtcttctgtcagaagcacagagatgaggtagttgctgaacatccagatgcttca
tccgaagagattgaagaattgctcgaatcacagtggaatatgcttaatgaaaagcagaaa
gctcgttataacacaaagtttgccatagtgacctctcccaaatctgaagaagactctggt
aacttacatggaaaaaaaagaaaccatacaaagaggacacagcaccctacagaagatttt
gaagttcaggaaccagctaggaaaagactcaggatggataaacacaataatcggaagagg
gagacaagcagtgacaaaacagccaaaacaaactcttctaaggtcacagaaacctcctct
tccctaaagaaccagtcagcaacgaaaaatctgtctgatgcatgtaaaccactgaagaag
cgaaatcgggcttcagcagcagaatcttcaactcttgcgtttagcaaaagttcatctcct
tcaacttccttaactgagaatgagatctcagatggtcaaggagatgaaccttcagaatcc
ccatacgaaagcgcagatgagactcaaactgaaatatctatatcttctaaaaagtctgaa
cgaggaactacagctaaaagggaatatgtttgtcagctttgtgaaaaatctggaaatctc
ctactttgtgaaggaccctgttatggagcttttcatttatcctgccttgggctttctaga
agaccagaaggaaaattcatttgcagtgaatgtacttcaggcattcactcatgctttgtt
tgtaaagagaaaaaaacagaagtgaaacgctgtgttgtatcccagtgtggaaaattttac
catgaagcatgtgtgaaaaaataccaccttactgtatttgagagccgaggatttcgttgt
cccctccacagctgtgtaagctgtcatgtaacaaatccttcaaatccaagatcatcaaaa
ggtaaaatgatgcgatgtgttcgctgtcctgttgcttatcatggaggagatggctgtttg
gctgcaggttgttcagtgattgcatctaacaatattatttgcactaatcatttcactgct
cggaaaggaaaaagtcatcatgctcatgtgaatgtgagctggtgctttgtgtgctcaaaa
ggaggaagcctgttatgctgtgagtcatgtccagcagcgtttcatccagactgtttgaat
attgaaatgccagatgggagttggtattgtaatgactgcagagctggaaaaaagcttcat
tttcaagacatcatttgggtcaaacttggaaattacagatggtggcctgcagaagtttgc
catccaaaaaatgttcctccaaatattcagaaaatgaagcatgagattggagagtttcct
gtgtttttctttgggtctaaagattattactggacacatcaggcacgagtctttccttac
atggaaggagatcggggaagcagatatcaaggaattaaaggaattggaaaagtcttcaaa
aatgcactgcaagaagctgaagctcgttttcgagaaataaagcttcagcgggaagccaga
gaaacccaggaaaatgaacgtaaacctccaccttacaaacacattaaggtgaataaacct
tgtggaaaagttcagatatatacagctgatatttctgaaattcccaaatgcaactgcaag
cccacggatgaaaatccctgtggttttgactcagagtgtttaaatcggatgttaatgtat
gagtgccatcctcaagtttgtccagcaggagagcagtgccaaaatcagtgctttaccaaa
cgtcagtacccagagacgaagatcattaaaactgatggcaaaggttggggcctggttgcc
aagagggatattaaaaagggagaatttgtgaatgagtatgttggtgaattaattgatgaa
gaagaatgtatggcaagaatcaagtatgcacatgaaaatgatatcacacatttctatatg
cttactattgataaggaccggataattgatgctggtcccaaaggaaactattcccgattc
atgaatcacagctgccagccaaattgtgagactctgaaatggacagtaaatggagatact
cgtgtgggattgtttgctgtatgtgatattcctgcagggacagaactgacttttaattac
aaccttgattgtctgggcaatgaaaaaactgtctgtcgatgtggtgcctctaactgtagt
ggattccttggtgatagaccaaagaactcagctgctctttcttcagaggagaagggcaaa
aagactaagaaaaagacaaggagacgtagaacaaaaggtgaaggaaaaaaagaatctgaa
gatgattgttttcgttgtggtgatggaggtcagttggtactatgtgatcggaaatgttgt
actaaagcttatcacctctcctgtctggatttggttaaacgaccttttgggaaatgggaa
tgcccttggcatcattgtgatgtatgcggcaaaccatcagtttctttctgtcatttctgc
ccaaattccttttgcaaggatcaccaagatgggacagtcttcagcaccacacaagatgga
cggttacgctgctctgaacatgagtttggagtggaatctattagaaacccaaagactgag
aaacccttcccagaaccaaccaagttgaagcccaagagaaagaaaagaaggtgttggagg
agaaaaacagagtacaaatag

DBGET integrated database retrieval system