KEGG   Sarcophilus harrisii (Tasmanian devil): 100913510Help
Entry
100913510         CDS       T02286                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05034  Alcoholism
shr05165  Human papillomavirus infection
shr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    100913510 (HDAC8)
  09164 Substance dependence
   05034 Alcoholism
    100913510 (HDAC8)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    100913510 (HDAC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100913510 (HDAC8)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100913510 (HDAC8)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100913510 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100913510
NCBI-ProteinID: XP_003765880
Ensembl: ENSSHAG00000015122
UniProt: G3WQV6
LinkDB All DBs
Position
3
AA seq 379 aa AA seqDB search
MQEAEEPAPPPRQPPVPPVYIYSPEYVRTCDSLAKVPKRASMVHSLIEAYELLKEMRVVK
PKVASMEEMASFHTDAYLQHLQKVSEEGDDEHPDSVEFGLGYDCPSTEGIFDYAAAVGGA
TITAAQCLIDGKCNIAINWAGGWHHAKKDEASGFCYLNDAVLGILHLRRKFDRILYIDLD
LHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIRDE
KYYQVCKSVLKEVYVAFNPKAVVLQLGADTIAGDPMCSFNLTPVGLGKCLKYILQWQLAT
LILGGGGYHLANTARCWTYLTGVILGRTLSSEIPDHEFFTEYGPDYVLEITPSCRPDRNE
LHQIQHILSRIMGNMKHVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggcggaggagcccgcgccccctccgcggcagccgcctgtgcccccagtctac
atctatagccccgagtacgtccgaacttgtgactcgctggccaaggtgcccaagcgggcc
agcatggtgcactccctgatcgaagcctatgagctgctgaaggaaatgagggtagtgaag
cccaaggtggcttccatggaggagatggccagcttccacacggatgcctatctgcagcac
ctccagaaggtcagtgaggaaggggatgacgagcatcctgactccgtggaattcggcctg
ggctacgactgccccagcacggagggcatatttgattatgcggctgcagtggggggggcc
accatcacggcggcccaatgcctgattgatggaaaatgtaacatagccattaactgggct
ggaggttggcaccatgccaagaaagatgaagcttcaggcttctgttacctcaatgatgct
gtcctagggatcctgcatttgagaaggaagtttgaccgcattctgtacattgacttggac
cttcaccatggagatggcgtcgaagatgctttcagtttcacttctaaagtcatgaccgtg
tctctgcacaaattttctccagggttttttccaggaactggcgatgtatctgatgtgggc
ctcgggaagggaaggtattacagcgtcaacgtgccgatccaggatggcatacgagatgaa
aagtattaccaggtctgcaaaagtgtcctcaaggaggtctatgtagccttcaatcccaaa
gctgtggttttacaattaggagctgacactatagctggggacccaatgtgttcatttaac
ttgactcctgtgggacttggcaagtgtcttaagtacatccttcagtggcagttggccacc
ctcatcttgggaggaggaggctaccaccttgccaacacagcccgatgctggacatacttg
actggggtcatcctggggagaacactctcgtctgagattccagatcatgaatttttcact
gaatatggcccggattatgtgttggaaatcacccccagctgccggcctgaccgcaatgag
ttgcaccaaatccagcatatcctgagtcgtattatggggaacatgaagcatgtggtttag

DBGET integrated database retrieval system