KEGG   Sarcophilus harrisii (Tasmanian devil): 100913901
Entry
100913901         CDS       T02286                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04068  FoxO signaling pathway
shr04270  Vascular smooth muscle contraction
shr04650  Natural killer cell mediated cytotoxicity
shr04720  Long-term potentiation
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04928  Parathyroid hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100913901 (ARAF)
   04012 ErbB signaling pathway
    100913901 (ARAF)
   04068 FoxO signaling pathway
    100913901 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100913901 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100913901 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100913901 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    100913901 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100913901 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100913901 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100913901 (ARAF)
   04720 Long-term potentiation
    100913901 (ARAF)
   04730 Long-term depression
    100913901 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913901 (ARAF)
   05205 Proteoglycans in cancer
    100913901 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100913901 (ARAF)
   05212 Pancreatic cancer
    100913901 (ARAF)
   05225 Hepatocellular carcinoma
    100913901 (ARAF)
   05226 Gastric cancer
    100913901 (ARAF)
   05214 Glioma
    100913901 (ARAF)
   05221 Acute myeloid leukemia
    100913901 (ARAF)
   05220 Chronic myeloid leukemia
    100913901 (ARAF)
   05218 Melanoma
    100913901 (ARAF)
   05211 Renal cell carcinoma
    100913901 (ARAF)
   05219 Bladder cancer
    100913901 (ARAF)
   05215 Prostate cancer
    100913901 (ARAF)
   05213 Endometrial cancer
    100913901 (ARAF)
   05224 Breast cancer
    100913901 (ARAF)
   05223 Non-small cell lung cancer
    100913901 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100913901 (ARAF)
   05160 Hepatitis C
    100913901 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100913901 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100913901 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    100913901 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100913901 (ARAF)
   01522 Endocrine resistance
    100913901 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100913901 (ARAF)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100913901 (ARAF)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100913901 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like APH C1_2 Kdo TUG-UBL1
Other DBs
NCBI-GeneID: 100913901
NCBI-ProteinID: XP_012408875
Ensembl: ENSSHAG00000006228
LinkDB
Position
X
AA seq 624 aa
MMRRGPTATPVGSSRSLTAAEDPAATPSSSSRVGGTVKVYLPNQQRTVVTARDGMTVSDS
LDKALKVRGLNQDCCAVYHLVQGRKTATAWDAAIAPLHGEELTVEVRADVPLAAAHNFAR
KTFLAPTFCDFCRRFLFHGFRCQTCGYKFHQHCSARVPTVCVDMATARQPCYRSVQDLTG
GPGAPEPQSGGQALCESHTPKSPRTQTPASHGETFAFPGSGGPPLQRIRSTSTPNVHMIS
TTMPVDSRLVQQAAQAFTAEGTGGERTPQSSPSPSLVSPPGRKSPHPKFSSEPLERKSSA
SADDKKKVKSLGYRDSGYYWEVAPGEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQP
TAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPDFAIITQWCEGSSLYHHLHVADTHFDM
VQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQQV
EQPTGSVLWMASEVIRMQDKNPYSFQSDVYAYGVVLYELMSGSLPYSHINNRDQIIFMVG
RGYLSPDLTKVSNNCPKAMKKLLADCLRFQREERPLFPEILVTIELLQRVLPKIERSASE
PSLHRAQTEELPSSLLGALRLFGP
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgatgagacgaggcccaactgccacccccgtaggatcctccaggagcctaaccgcagca
gaagatcctgctgcgaccccttcgagcagcagtcgggtagggggcactgtgaaggtctat
ctgcccaaccagcagcgtacagtggtaaccgcccgggatggaatgaccgtctccgactca
ctggacaaggcactgaaggtgcggggactgaaccaagactgctgtgctgtctatcacctt
gtacagggccggaagacagcaacggcctgggatgcagccattgctcctttgcatggggaa
gaactgacggtcgaggtccgggctgatgttccactcgcagctgcccacaactttgcccgg
aagacattcctggctcccaccttctgcgacttctgccgccgcttcctctttcatggcttc
cgctgccagacatgtggctacaagttccaccaacactgcagtgcccgggtccccaccgtc
tgtgttgacatggctaccgcccgccaaccttgctaccgcagtgtccaggacttgactgga
ggccctggtgctcctgagccccagtctggaggccaggctctgtgtgagtcccacacccca
aagagtcccaggacacaaacaccagcctcccacggggagacttttgctttccctgggtct
ggaggcccacccctccagaggatccgctctacatccacacccaatgtgcacatgatcagc
accacgatgcctgtggacagtaggctcgtacagcaggcagcccaggccttcactgctgaa
ggaacaggtggggaaaggaccccccaaagcagtcctagccccagccttgtgtccccccct
ggaaggaaatccccacaccccaagttttcatcagagccccttgagcgcaagtcctcagct
tcagctgatgataagaagaaagtgaagtccctgggttaccgagactcaggctactactgg
gaggtggccccaggggaggtgcagctgctgaagaggatcgggacgggctcctttgggacc
gtgttccgtggacgatggcacggagacgtggccgtgaaggtgctaaaggtggcacagccc
acggctgagcaagcacaggccttcaagaacgagatgcaggtcctcaggaagacgcgccac
gtgaacatccttttgttcatgggcttcatgacaaggcccgactttgccatcatcacccag
tggtgtgagggttccagcctctaccaccacctgcacgtggctgacactcactttgacatg
gtacagctcattgacgtggcgcgacagacggctcagggcatggattacctccatgccaag
aacatcattcaccgagacctcaagtccaacaatatcttcctacacgagggactgacggtg
aagatcggagactttgggctggccactgtcaagactaggtggagtggcgcccagcaagtg
gaacagcccactggctctgtgctctggatggcctctgaagtgatccgcatgcaggacaag
aacccctacagcttccagtctgacgtctatgcctatggcgtcgttctctatgagctcatg
agtggcagtcttccctatagccacatcaacaacagagatcagatcatcttcatggtgggc
agaggctatctgtcgccagacctcaccaaggtgtccaacaactgccccaaagccatgaag
aagctgctggccgactgtctgcgcttccagcgggaagagcggcccctctttcctgagatc
ctggtcaccatagagctgctgcaacgggtgctgcctaagatcgagcgcagcgcatcggaa
ccgtcgctgcaccgggctcagacggaggagctgccttcgtccctgctgggagccctgcgc
ctctttgggccgtag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100934801
Entry
100934801         CDS       T02286                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04015  Rap1 signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04150  mTOR signaling pathway
shr04270  Vascular smooth muscle contraction
shr04510  Focal adhesion
shr04650  Natural killer cell mediated cytotoxicity
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100934801 (BRAF)
   04012 ErbB signaling pathway
    100934801 (BRAF)
   04015 Rap1 signaling pathway
    100934801 (BRAF)
   04068 FoxO signaling pathway
    100934801 (BRAF)
   04024 cAMP signaling pathway
    100934801 (BRAF)
   04150 mTOR signaling pathway
    100934801 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100934801 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100934801 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100934801 (BRAF)
   04062 Chemokine signaling pathway
    100934801 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100934801 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100934801 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100934801 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100934801 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100934801 (BRAF)
   04720 Long-term potentiation
    100934801 (BRAF)
   04730 Long-term depression
    100934801 (BRAF)
   04722 Neurotrophin signaling pathway
    100934801 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934801 (BRAF)
   05205 Proteoglycans in cancer
    100934801 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100934801 (BRAF)
   05212 Pancreatic cancer
    100934801 (BRAF)
   05225 Hepatocellular carcinoma
    100934801 (BRAF)
   05226 Gastric cancer
    100934801 (BRAF)
   05214 Glioma
    100934801 (BRAF)
   05216 Thyroid cancer
    100934801 (BRAF)
   05221 Acute myeloid leukemia
    100934801 (BRAF)
   05220 Chronic myeloid leukemia
    100934801 (BRAF)
   05218 Melanoma
    100934801 (BRAF)
   05211 Renal cell carcinoma
    100934801 (BRAF)
   05219 Bladder cancer
    100934801 (BRAF)
   05215 Prostate cancer
    100934801 (BRAF)
   05213 Endometrial cancer
    100934801 (BRAF)
   05224 Breast cancer
    100934801 (BRAF)
   05223 Non-small cell lung cancer
    100934801 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100934801 (BRAF)
   05160 Hepatitis C
    100934801 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100934801 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100934801 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100934801 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100934801 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100934801 (BRAF)
   01522 Endocrine resistance
    100934801 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100934801 (BRAF)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100934801 (BRAF)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100934801 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100934801
NCBI-ProteinID: XP_031795065
Ensembl: ENSSHAG00000016011
LinkDB
Position
5
AA seq 806 aa
MAALSGGGGGGGGGGAEQGPALFNGDMDPETGAGSASSAEPAIPEEVWNIKQMIKLTQEH
IEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVSSSASTDTV
TSSSSSSLSVAPSSLAVFQNPTDMSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDS
LKKALMMRGLIPECCAVYRRQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRK
TFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPI
PQEEASLGETTLTSGSSPSAPPSDSIGPPLLTPSPSKSIPIPQPFRPADEDHRNQFGQRD
RSSSAPNVHINTIEPVNIDDLIRDQGLRGDGAPLNQLMRCLRKYQSRTPSPLLHSVPSEI
VFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTL
GRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNE
VGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTA
QGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMA
PEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKV
RSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTE
DFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcggcggcggcggcgcggagcagggcccc
gctctgttcaacggggacatggatcccgagactggcgccggctcggcatcctccgccgag
ccggccatccccgaggaggtatggaatatcaagcaaatgataaaattgacacaggaacac
atagaagccctattggacaaatttggaggagaacataacccaccatcaatctatctcgag
gcctatgaagaatacaccagcaagctagatgcacttcaacaacgggaacaacaattatta
gagtccatggggaatggaactgatttttctgtttctagctcagcttcaacagacacagtt
acatcttcttcctcttctagcctgtcagtggcaccttcatctcttgcagtttttcagaat
cccacagacatgtcaagaagcaatcccaagtcaccacaaaaaccaattgttagagtcttc
ctgcccaacaaacagaggactgtggtaccagcaagatgtggagtaactgtccgagatagt
ctaaagaaggcattgatgatgagaggcttgatcccagaatgctgtgcagtgtacagaaga
caggatggagagaagaagcctattggctgggacactgatatttcctggcttactggagaa
gaactgcatgtagaagttttggagaatgttcccctaacaacacacaattttgtacggaag
acatttttcactttagcattctgtgacttttgtcgaaagctgcttttccaaggtttccgc
tgtcagacatgtggttataaatttcaccaacgctgtagtacagaggtgccactgatgtgt
gttaattatgaccaacttgatttgctgtttgtctccaagttctttgaacatcacccaata
ccgcaggaggaggcctccttaggagagaccacccttacgtcgggatcatccccttcagca
cccccctcagattccattgggcccccacttcttactccatcgccttcaaaatccattcca
atcccacagccctttcgaccagcagatgaggatcatcggaaccagtttgggcaacgtgac
aggtcctcatcagctcccaatgtgcatataaacacaatagagcctgtcaatattgatgac
ttgattagagaccaagggttacggggtgatggagcccccttgaaccaactgatgcgctgt
cttcggaaataccaatcccggactcccagtcccctcctacattctgtccccagtgaaata
gtgtttgattttgagcctggcccagtgttcagaggatctactacagggttgtctgccact
cctcctgcttccttgcctggatctctaactaatgtgaaagcattacaaaaatctccagga
cctcagcgtgaaagaaaatcttcatcatcttctgaagacaggaatagaatgaaaaccctt
ggtcgacgagactcaagtgatgattgggaaattccagatgggcagattacagttggacaa
aggataggatctggatcatttggaacagtctataaggggaaatggcatggtgatgtagct
gtgaaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaa
gtaggagtgctcaggaaaacacgacatgtgaatatcctactctttatgggctattcaaca
aaaccacagttggccattgttacacagtggtgtgaaggctccagtttatatcaccatcta
catatcattgagaccaaatttgagatgatcaagctaatagatattgcacggcaaacagca
caaggcatggattatttacatgccaagtccatcatccatagagacctcaagagtaataat
atatttcttcatgaagacctcacagtaaaaataggagattttggtctggctacagtaaag
tcacgatggagtggttcccatcagtttgaacagttatctggatccatcttgtggatggca
ccagaggtcattagaatgcaagataaaaacccatatagttttcaatcagatgtatatgca
tttgggattgttctgtatgagttgatgacaggacagttaccttactcaaacatcaacaac
agggaccagataatttttatggtggggcgaggatacttgtcgccagatcttagtaaggtg
cggagtaattgtccaaaagccatgaagaggttaatggcagagtgcctgaagaagaagaga
gatgagaggccactttttccccagattcttgcctccattgaacttctggcccgctcattg
ccaaaaattcaccgcagtgcatctgaaccctcattgaatcgggctggcttccaaacggag
gattttagtctgtatgcttgtgcttctccaaaaacacccatccaggcagggggatatgga
gaatttgccgccttcaagtag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100935202
Entry
100935202         CDS       T02286                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04024  cAMP signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04218  Cellular senescence
shr04270  Vascular smooth muscle contraction
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04371  Apelin signaling pathway
shr04510  Focal adhesion
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04613  Neutrophil extracellular trap formation
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04666  Fc gamma R-mediated phagocytosis
shr04720  Long-term potentiation
shr04722  Neurotrophin signaling pathway
shr04726  Serotonergic synapse
shr04730  Long-term depression
shr04810  Regulation of actin cytoskeleton
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04914  Progesterone-mediated oocyte maturation
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04917  Prolactin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04926  Relaxin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04929  GnRH secretion
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05034  Alcoholism
shr05132  Salmonella infection
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05164  Influenza A
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100935202 (RAF1)
   04012 ErbB signaling pathway
    100935202 (RAF1)
   04014 Ras signaling pathway
    100935202 (RAF1)
   04015 Rap1 signaling pathway
    100935202 (RAF1)
   04370 VEGF signaling pathway
    100935202 (RAF1)
   04371 Apelin signaling pathway
    100935202 (RAF1)
   04630 JAK-STAT signaling pathway
    100935202 (RAF1)
   04068 FoxO signaling pathway
    100935202 (RAF1)
   04072 Phospholipase D signaling pathway
    100935202 (RAF1)
   04071 Sphingolipid signaling pathway
    100935202 (RAF1)
   04024 cAMP signaling pathway
    100935202 (RAF1)
   04022 cGMP-PKG signaling pathway
    100935202 (RAF1)
   04151 PI3K-Akt signaling pathway
    100935202 (RAF1)
   04150 mTOR signaling pathway
    100935202 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100935202 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100935202 (RAF1)
   04218 Cellular senescence
    100935202 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100935202 (RAF1)
   04540 Gap junction
    100935202 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100935202 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100935202 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100935202 (RAF1)
   04625 C-type lectin receptor signaling pathway
    100935202 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100935202 (RAF1)
   04660 T cell receptor signaling pathway
    100935202 (RAF1)
   04662 B cell receptor signaling pathway
    100935202 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100935202 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100935202 (RAF1)
   04062 Chemokine signaling pathway
    100935202 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100935202 (RAF1)
   04929 GnRH secretion
    100935202 (RAF1)
   04912 GnRH signaling pathway
    100935202 (RAF1)
   04915 Estrogen signaling pathway
    100935202 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100935202 (RAF1)
   04917 Prolactin signaling pathway
    100935202 (RAF1)
   04921 Oxytocin signaling pathway
    100935202 (RAF1)
   04926 Relaxin signaling pathway
    100935202 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100935202 (RAF1)
   04919 Thyroid hormone signaling pathway
    100935202 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100935202 (RAF1)
   04916 Melanogenesis
    100935202 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100935202 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100935202 (RAF1)
   04720 Long-term potentiation
    100935202 (RAF1)
   04730 Long-term depression
    100935202 (RAF1)
   04722 Neurotrophin signaling pathway
    100935202 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100935202 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935202 (RAF1)
   05206 MicroRNAs in cancer
    100935202 (RAF1)
   05205 Proteoglycans in cancer
    100935202 (RAF1)
   05230 Central carbon metabolism in cancer
    100935202 (RAF1)
   05231 Choline metabolism in cancer
    100935202 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100935202 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100935202 (RAF1)
   05212 Pancreatic cancer
    100935202 (RAF1)
   05225 Hepatocellular carcinoma
    100935202 (RAF1)
   05226 Gastric cancer
    100935202 (RAF1)
   05214 Glioma
    100935202 (RAF1)
   05221 Acute myeloid leukemia
    100935202 (RAF1)
   05220 Chronic myeloid leukemia
    100935202 (RAF1)
   05218 Melanoma
    100935202 (RAF1)
   05211 Renal cell carcinoma
    100935202 (RAF1)
   05219 Bladder cancer
    100935202 (RAF1)
   05215 Prostate cancer
    100935202 (RAF1)
   05213 Endometrial cancer
    100935202 (RAF1)
   05224 Breast cancer
    100935202 (RAF1)
   05223 Non-small cell lung cancer
    100935202 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100935202 (RAF1)
   05161 Hepatitis B
    100935202 (RAF1)
   05160 Hepatitis C
    100935202 (RAF1)
   05164 Influenza A
    100935202 (RAF1)
   05163 Human cytomegalovirus infection
    100935202 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100935202 (RAF1)
   05165 Human papillomavirus infection
    100935202 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100935202 (RAF1)
   05152 Tuberculosis
    100935202 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100935202 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100935202 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100935202 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100935202 (RAF1)
   01522 Endocrine resistance
    100935202 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100935202 (RAF1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100935202 (RAF1)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100935202 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Zf_RING
Other DBs
NCBI-GeneID: 100935202
NCBI-ProteinID: XP_003762495
Ensembl: ENSSHAG00000011099
UniProt: G3WC19
LinkDB
Position
1
AA seq 647 aa
MEHFQGAWKTISNGFGFKDSVFDGSGCISPTLVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKTRLEWNTDAAS
LVGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSNVGDSGVPALPPLTMRRMRESVSQIPISSQHRYSTPHAFTF
STSPPSSEGSLSQRQRSTSTPNVHMVSTTMPVDSRIIEDAIRSHSESASPSALSSSPNNL
SPTGWSQSKTPVPAHRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVIDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINSCTLTSTRLPVF
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggagcattttcagggagcttggaagacgatcagtaacggttttggattcaaagattca
gtctttgatggctccggctgtatttctcctactcttgtccagcagtttggctatcagcgc
cgggcatcagatgatggcaaacttacagattcctccaaaacaagtaatactatccgagtt
ttcttgccaaacaagcaaaggactgtggttaatgttcgaaatggaatgaccttgcatgat
tgccttatgaaagctcttaaagtgagaggcctccagccagaatgttgtgcagtgtttcgt
cttctccatgaacataaagggaaaaaaacacgtttagagtggaatactgatgcagcctct
ttggtgggagaagaacttcaagtagattttctggatcatgttcccctcacaacacacaat
tttgctcgaaaaactttcctgaagcttgccttctgtgatatatgtcagaagttcctcctg
aatggatttcgatgtcagacatgtggctacaagttccatgagcattgtagcactaaggtc
cccaccatgtgtgtggattggagtaatatcagacagctcttattgtttccaaattccaat
gttggtgatagtggtgtaccagcactacctcctctaacgatgcgtcggatgcgagagtct
gtttcccagatccccattagttcccagcacaggtattccacaccccatgccttcacgttc
agcacatcgccgccatcctcggagggctccctttcccagaggcagaggtctacgtccact
ccaaatgtccacatggtcagcaccaccatgccagtggacagtcggattatagaggatgca
attcgaagtcacagtgaatcagcctcaccttcagctttgtccagtagtccaaacaacctg
agtccaactggctggtctcagtccaaaacacctgttccagcacacagagaaagagccccg
ggatccagtacacaagaaaaaaataaaattaggccacgtggacagagggattcaagctat
tactgggaaatagaagccagtgaggtcatgttatcaaccagaatagggtcgggatccttt
gggacagtgtacaagggcaaatggcatggagatgttgctgtaaagatattaaaagtcatt
gatccaactccagaacagcttcaggctttcaggaatgaagtggctgtcttaagaaaaacc
aggcatgttaacattctgttgttcatgggttatatgactaaagataacctggccattgtg
acacagtggtgtgaggggagcagtctttataaacacctccatgtccaggagaccaaattt
caaatgttccaacttatagatattgcccggcagacagcgcaaggaatggattatttacat
gcaaagaacatcatccacagggacatgaaatcaaataatatatttcttcatgaaggtttg
acagtgaaaataggagactttggtttggcaacagtaaaatctagatggagtggctctcaa
caagtggaacagccaacaggttccattctctggatggctccagaagttatccgcatgcag
gacaataatccattcagctttcagtcggatgtctattcttatggcattgtgctgtatgaa
ctgatgacaggagagctaccatattcgcacatcaacaaccgagatcagattatatttatg
gttggccgaggatatgcatctccagatctcagtaagctatacaagaattgccccaaggct
atgaagaggctggtagcagattgtgtgaagaaagttaaggaagaaagacccctttttcca
cagatactgtcttccattgagttactccaacattctttaccgaaaatcaaccgcagtgct
tctgaaccatctctacaccgtgcagcccacacagaggacataaactcatgcacattgaca
tccacaagactcccagttttctag

DBGET integrated database retrieval system