KEGG   Sarcophilus harrisii (Tasmanian devil): 100913968
Entry
100913968         CDS       T02286                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04015  Rap1 signaling pathway
shr04145  Phagosome
shr04151  PI3K-Akt signaling pathway
shr04360  Axon guidance
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04514  Cell adhesion molecules
shr04530  Tight junction
shr04611  Platelet activation
shr04670  Leukocyte transendothelial migration
shr04810  Regulation of actin cytoskeleton
shr05100  Bacterial invasion of epithelial cells
shr05133  Pertussis
shr05135  Yersinia infection
shr05140  Leishmaniasis
shr05145  Toxoplasmosis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100913968 (ITGB1)
   04151 PI3K-Akt signaling pathway
    100913968 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100913968 (ITGB1)
   04514 Cell adhesion molecules
    100913968 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100913968 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100913968 (ITGB1)
   04530 Tight junction
    100913968 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100913968 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100913968 (ITGB1)
   04670 Leukocyte transendothelial migration
    100913968 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    100913968 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100913968 (ITGB1)
   05205 Proteoglycans in cancer
    100913968 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100913968 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100913968 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100913968 (ITGB1)
   05414 Dilated cardiomyopathy
    100913968 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100913968 (ITGB1)
   05133 Pertussis
    100913968 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    100913968 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100913968 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100913968 (ITGB1)
   05140 Leishmaniasis
    100913968 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100913968 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100913968 (ITGB1)
   04515 Cell adhesion molecules [BR:shr04515]
    100913968 (ITGB1)
   04090 CD molecules [BR:shr04090]
    100913968 (ITGB1)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100913968 (ITGB1)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100913968 (ITGB1)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin beta subunits
   100913968 (ITGB1)
CD molecules [BR:shr04090]
 Proteins
  100913968 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 100913968
NCBI-ProteinID: XP_031795581
Ensembl: ENSSHAG00000016377
LinkDB
Position
5
AA seq 802 aa
MSLQLIFWVGLVSCSISQVLSQTGGNDCLKANAKSCGECIQAGPNCGWCTNSSFLQEGMP
TSARCDDLEALEKKGCRPQDIENPRGHKTIRKNKNVTNRSKGTAEKLQPEDITQIQPQQL
TLKLRSGEPQTFALKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMYEMKRITSD
FRIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTDKGEVFNELVGKQ
HISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDG
RCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQAVYKELKNLIPKSAVGT
LSANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNIS
IGDEVQFEISITSNKCPKKDTETIKIKPLGFTEEVEITLQFICECECQSEGLPNSPECHE
GNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCR
KRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSSC
MASNGQICNGRGICVCGSCKCTDSKFQGATCEMCQTCLGVCAEHKECVQCRAFDKGEKKD
TCAEECPYFNITKVKSREDLPQPGQREALSHCKEKDVDDCWFYFTYSVNGNNEVVVHVVE
TPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDAQE
NPIYKSPINNFKNPNYGRKAGL
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgagtttacaactaattttctgggttggactggtcagttgctcaatcagtcaagtactc
agccaaacaggtggaaatgattgcttaaaagcaaatgcaaaatcatgtggagaatgtata
caagcaggaccaaattgtggatggtgtacaaactcctcatttttacaagaaggaatgcct
acttctgcccggtgtgatgacttagaagcattagaaaagaaaggctgccgtccacaggat
atagaaaatcctcgaggccacaaaactatccgtaaaaataaaaatgtgacaaatcgcagt
aaaggtacagcagaaaaactccagcctgaagacattacccagatccaaccacagcagcta
accttgaagttacgttcgggagaaccacaaacatttgcattaaaattcaagagagctgaa
gactaccctattgacctctattatcttatggatctctcttactctatgaaagatgacttg
gagaatgtgaagagtcttggaacagatctaatgtatgagatgaagagaatcacttcagat
ttccgaattggattcggctcctttgtagagaagactgtgatgccgtacatcagcaccaca
ccggccaagctcaggaacccttgcacaggcgaccagaactgtaccagtcccttcagctac
aagaatgtgctcagccttacagacaagggggaggtgtttaatgagcttgtggggaagcag
cacatttctggcaatttggactctccagaagggggatttgatgccattatgcaggttgca
gtctgtgggtcattaattggctggagaaatgttacacgactattggttttttccactgat
gctggttttcactttgctggagatggtaaacttggtggaattgttttaccaaatgatgga
agatgtcacctagaaaataatgtatacacaatgagccattattacgattatccttctatt
gctcatcttgtccaaaaactaagtgaaaataacattcaaacaattttcgcagttacagaa
gaatttcaggctgtttacaaggaactgaagaatttgatccccaagtcagcagtgggaaca
ttgtctgcaaattccagcaatgtaattcagttgatcattgatgcatacaattccttatct
tcagaagtcattctggaaaatagcaaattgccagagggagtaacaataaattacaaatct
tactgcaaaaatggagtgaatgggacgggagaaaatggaagaaaatgttccaatatttcc
attggtgatgaggttcagtttgagattagtataacttccaacaaatgtcctaagaaagac
acagaaaccatcaaaattaaacctctaggtttcactgaagaagtagaaattacacttcag
tttatctgtgaatgtgagtgccagagtgaaggcctcccaaatagtccagaatgtcatgaa
ggaaatggaacatttgaatgcggggcctgccggtgcaatgagggacgtgttggtagacat
tgtgaatgtagtacagatgaagtaaacagtgaagacatggatgcttactgcaggaaagaa
aacagttctgaaatttgcagcaacaatggagaatgtgtctgtggacaatgtgtttgtaga
aagagagataatacaaatgaaatttattctggcaaattttgtgaatgtgacaatttcaac
tgtgatagatccaatggattgatttgtggaggaaatggtgtttgcaagtgtcgagtttgt
gaatgtaaccccaattacactggcagtgcctgtgattgttctttggatacatcttcatgt
atggcatcaaatgggcagatttgcaacggccgaggaatatgtgtatgtggttcctgtaaa
tgcaccgattctaaatttcaaggggccacttgtgaaatgtgtcagacttgtcttggtgtc
tgtgctgagcacaaagaatgtgttcagtgcagagcttttgataaaggagaaaaaaaagac
acatgtgcagaagagtgtccatacttcaacattaccaaagtaaaaagtcgagaagaccta
ccccagcctggccagcgagaggctctatcccactgtaaagagaaggatgttgatgattgc
tggttctattttacatattcggtcaatggaaacaatgaagttgttgttcatgtggtggag
acaccagagtgtcccactggtccagacatcattcccattgtagctggagtggttgcagga
attgtgctgattggtcttgcattactgctgatttggaagttgctgatgataatacatgac
agaagagaatttgctaaatttgaaaaggagaaaatgaatgcaaaatgggatgcgcaagaa
aatccgatttacaagagtcctattaataatttcaagaatccaaactatggacgtaaagct
ggtctctaa

DBGET integrated database retrieval system