KEGG   Sarcophilus harrisii (Tasmanian devil): 100914209Help
Entry
100914209         CDS       T02286                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
shr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100914209 (GAA)
   00500 Starch and sucrose metabolism
    100914209 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100914209 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100914209 (GAA)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100914209 (GAA)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100914209 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100914209
NCBI-ProteinID: XP_003768705
Ensembl: ENSSHAG00000006285
UniProt: G3VVM7
LinkDB All DBs
Position
4
AA seq 955 aa AA seqDB search
MTVEEMSHPRHLRWLILAGCGAAVLLIPTLLRASLLHVSVVISREFKDISSGQQGIYRTG
QEATEKAWDQPHQGSPRNPAGAPLQCDISPDYRFDCAPEKTLTQEQCEARGCCYVPVAQK
GFFQIGRPWCFFPPSYPSYKLENLTTTRTGYAATLTRTVPTFFPKDILTLHLEVQMETES
RLHFTIKDPANPRYEVPMETPKVTHRAPTQLYSVAFENNPFGLVITRKSNGMVMLNTTIA
PLFFADQFLQITTSLPSQFITGLGEHQTPLILNTNWTKITFWNRDMAPVPKANLYGSHPF
YLCLEDGGLAHGVFLLNSNAMDVVLQPRPALTWRAIGGILDFYVFLGPEPKNVVQQYLEV
VGYPFMPPYWGLGFHLCRWGYSSTTVTREVVKNMTTANFPLDVQWNDLDYMDAGRDFTFN
QDNFWDFPAMVQEFHQSGRRYIMIVDPAISSSGLPGSYRPYDEGLKRGVFITNEKGQPLI
GKVWPGESAFPDFTNPHTQDWWYDMVKEFHTQVPFDGMWIDMNEPSNFVKGSVEGCPNNE
LEDPPYVPGVIGGTLRAATICVSSHQYLSSHYNLHNLYGLTEAIASHDALVKIRGKRPFV
ISRSTFAGHGHYAGHWTGDVFSNWEQLYYSVPAVLLFNLYGIPLVGADICGFLNNTTEEL
CVRWTQLGAFYPFMRNHNNKYNQPQEPYVFSEEAQKAMRRAFTLRYMLLPYLYTLFHKAH
SRGETVARPLFLEFPLDQNTWTLDRQFFWGEALLITPVLEVGKVEVNGYFPSGTWYPLLE
IPMEPLNDLSPSSSALNDSVIHSKGQWFTLPAPLDVINIHLRAGYILPLQDPGLTTTESR
NKPMTLIVALTPSGVAQGELFWDDGETLGTVEWGHYTQIMFLANNNVILNDLVQVSSEGT
SLKLRKVTVLGVTNDPHQVVSNGVPVFNFSYSADTKILDIPVSLSVGEQFLISWS
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggaagagatgtcacatccccggcacttgcgctggctaattttggcaggctgt
ggtgctgctgtcttgctgattcctactctcctgagggcttctcttctccatgtatcagtc
gtgatttctagagaattcaaagacatctcctcaggacaacagggcatctacagaactggc
caagaggcaacagaaaaggcctgggaccagccccatcaagggtctcctagaaaccctgct
ggagctcctttgcagtgtgacatctcccctgattaccgctttgactgtgctccagaaaag
accctcactcaggaacaatgtgaagcccgaggctgctgttatgtcccagtggctcagaag
ggattttttcagatagggaggccatggtgctttttcccacccagttaccccagctacaaa
ttggagaaccttaccaccacaaggacaggctatgctgctaccctgactcgcacagtgcct
acttttttccctaaggacatcctaaccctgcatttggaggtccagatggagacagaaagc
cgattgcattttacaatcaaagaccctgccaatccgcgttatgaggttcccatggaaacc
cctaaagtcactcacagggctcctactcagctctacagtgtggcatttgagaataatccc
tttggtttggtcataaccagaaagtcaaatggaatggtgatgctgaatacaactattgct
cccctgttctttgctgaccagtttctccagattactacttctcttccatcccagtttatc
actggccttggggagcatcagactcctctaatactcaacaccaactggaccaagattacc
ttttggaacagagacatggcacctgtgcctaaggccaatctctatggttcccatcctttc
tatctgtgtctggaagatggagggttggcccatggagtctttctgctaaacagcaatgct
atggatgtagtattacagccaagacctgccctgacctggagggcaatagggggaatactg
gacttctatgtcttcctgggaccagaaccaaagaatgtggttcaacagtacttggaagtt
gttggatacccattcatgccaccttattggggtctgggcttccatctgtgtcgatggggc
tactcctccaccactgtcacccgagaggtggtgaagaacatgaccacagctaattttcct
ctagatgtccagtggaatgacctagattacatggatgccgggagggacttcactttcaac
caggacaacttctgggactttccagccatggtgcaggagtttcatcagagtggccggcgg
tacatcatgattgtggatccagccatcagcagctccggtctccctgggagttacagaccc
tatgatgaaggcctgaaaagaggagtgttcatcaccaatgagaaggggcagcctctgatt
ggaaaggtttggcctggagaaagtgctttcccggatttcactaacccccatacccaggac
tggtggtatgacatggtgaaggagttccacactcaagtaccctttgatggcatgtggatt
gacatgaatgagccatctaactttgtaaaaggctctgtggaaggttgtcccaacaatgag
ctagaagatcctccctatgtgccaggtgtgattggagggaccctcagggcagccaccatc
tgtgtctctagccatcagtacttgtcttcccactacaatctgcacaatctgtatggactg
actgaagccattgcctcccatgatgccctggtaaagattcgggggaagcgtccctttgtg
atatctcggtctacttttgctggccatggccattatgctggccactggacaggagatgtg
tttagcaactgggaacagctgtactactctgtgccagcggtgctactctttaacttgtat
ggaatacctttggtgggagcagacatctgtggcttcttgaacaataccacagaagaactg
tgtgtgcgatggacccagctgggggccttctaccccttcatgaggaaccataataacaaa
tataatcagccccaggagccatatgtattcagcgaagaggctcagaaagctatgaggaga
gcctttaccttacgctacatgctcctgccctatctctataccctgttccacaaagcccat
tctcgtggagagactgtggctcggccactgtttttggagtttcccttagaccaaaacacc
tggacactggatcgacaattcttctggggagaagctctcctcattaccccagtacttgaa
gttggaaaggttgaagtgaatggttactttccctcaggcacatggtatccacttttggag
ataccaatggagcctcttaatgacctgtctccttcatcttctgctctcaatgactcagtc
atccatagcaaaggacagtggttcaccctgcctgcaccattagatgtgatcaatatccac
ctccgcgctggctatatccttccattgcaggatcctggacttaccaccacagagtcccgc
aataagccgatgaccttgattgtggccttaactcccagtggtgtggcccaaggggagctg
ttctgggatgatggagagacccttggtacagtggaatggggccactatactcaaatcatg
ttcctggctaacaataatgtcattctgaatgacctagtacaagtgtccagtgagggcacc
agcctgaaattgagaaaagtgactgtcttgggtgtgactaatgacccccatcaagttgtc
tctaatggtgtcccggtcttcaacttttcctacagtgctgataccaagatcctggacatc
cctgtgtctttgtcagtgggggaacagtttctcatcagctggtcttaa

DBGET integrated database retrieval system