KEGG   Sarcophilus harrisii (Tasmanian devil): 100914495Help
Entry
100914495         CDS       T02286                                 

Gene name
GATB
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00970  Aminoacyl-tRNA biosynthesis
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100914495 (GATB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:shr03029]
    100914495 (GATB)
Enzymes [BR:shr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100914495 (GATB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100914495 (GATB)
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100914495 (GATB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY MtrH
Motif
Other DBs
NCBI-GeneID: 100914495
NCBI-ProteinID: XP_012407624
Ensembl: ENSSHAG00000011763
UniProt: G3WE99
LinkDB All DBs
Position
6
AA seq 547 aa AA seqDB search
MAAPVLRGARAVRCWSLGVGPRRTRALFAESVSGRGSRRSSAAAREPRPGAHEWAAVVGL
EIHTQISSNSKLFSGSQVTFLAPPNSLVSFFDASLPGTLPVLNKRCVEAAVMTGLALNCT
VNKKSLFDRKHYFYADLPAGYQITQQRLPIAVNGSLTYNLGGGTHWSPSATKTVRIKQIQ
LEQDSGKSLHDDTRSQTLIDLNRAGVGLMEVVMEPDMSCGDEAATAVRELQLILRTLGTS
QANMAEGQLRVDANISVHHPGEPFGVRTEVKNLNSIRFLAKAIDYEIKRQIEELQNGGKI
LNETRAFDEKLGCTVSMRDKEGKQDYRFMPEPNLPPLILYDAESLPVAADPQQVVNIDWI
RERLPELPSVTRQRLVEQYGILPEHSFALLNEDGLLEFFQNVVKETRTEPKKVIGWILTT
FLGYLKQQNLAVSESPISPSLLAELLNLLDRKAISVPAAQQVFEELWHNKGKTPGQIIRE
KKLELLQNQEELEEICQAVLDKHPQEVTAVKKGNQKVVNKLIGLVRRATQGRADPGRIKQ
ILEKQLQ
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccgtgctgcgaggcgcacgggccgttcgctgctggtccctcggcgtcggt
ccgcgccgcaccagagcgctttttgccgagtctgtgtcgggccgggggagcaggcggagc
tccgcggcggcgcgggagccgaggccgggtgcacatgaatgggcagctgtggtgggtctg
gaaattcatacccagatctcttccaattcaaaactcttctctggatctcaagttaccttt
ttagcaccccctaattcgttggtttctttttttgatgcttccctacccggaacattgccg
gttctcaacaagagatgtgtggaggcagccgtgatgacaggcctggccctgaactgcact
gtaaacaagaagtctttatttgacagaaagcactacttctacgcagatctcccagccgga
tatcaaatcacccaacaaaggcttcccattgctgtgaatgggagcctgacatacaacctg
ggtgggggaacccattggagtccatcagctaccaaaacagtgagaatcaagcagatccaa
ttggagcaggacagcggcaagagccttcacgatgacacgaggtcccagacgctcatcgat
ctgaaccgggcaggagtcggccttatggaggttgtcatggagcccgatatgtcctgtggg
gatgaggcagcgacagccgtcagagaacttcaattgattcttcggactctggggaccagc
caagcaaatatggcagagggccagttgagagtggacgctaacatatctgtgcatcatcct
ggggagccttttggagttaggactgaagtgaagaatctcaacagcataagattcttggcc
aaagcaatagactatgaaattaagagacagattgaagaacttcagaatggaggcaaaatt
ctgaatgaaacgcgagcatttgatgagaaacttgggtgcactgtgtcaatgagggataaa
gaaggaaagcaagactaccggtttatgccagagcccaatcttcccccattgatcctatat
gatgctgagtccctgcctgtggctgcagacccccagcaagtggtaaatatcgattggatt
cgagagaggcttcccgagctccccagcgtgaccagacagaggcttgttgaacagtacggg
attttgcctgaacacagcttcgccctattgaatgaggatggactattggagttcttccaa
aatgtggtgaaagaaactagaacagaacccaaaaaagtgattggttggattcttaccact
tttctgggttatttaaagcaacagaaccttgctgtcagtgagagtcccatctcaccttct
ttgttggctgagcttctcaaccttctggaccgcaaagccatctccgtgcccgcagctcaa
caagtctttgaggaattgtggcacaacaaagggaagacgccgggccagatcattcgagag
aagaagcttgagctgctccagaaccaagaggagctggaagagatctgccaggccgtgctg
gacaagcatcctcaggaggtcacggcagtgaagaagggaaaccagaaagttgtgaataaa
ctgattggtttggtccgaagggcaacacaaggacgagcagatccgggcaggataaagcag
atcctggagaagcagctgcagtga

DBGET integrated database retrieval system