KEGG   Sarcophilus harrisii (Tasmanian devil): 100914649
Entry
100914649         CDS       T02286                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X2
  KO
K08525  retinoid X receptor beta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03320  PPAR signaling pathway
shr04659  Th17 cell differentiation
shr04919  Thyroid hormone signaling pathway
shr04920  Adipocytokine signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05216  Thyroid cancer
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100914649 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100914649 (RXRB)
   03320 PPAR signaling pathway
    100914649 (RXRB)
   04919 Thyroid hormone signaling pathway
    100914649 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100914649 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914649 (RXRB)
   05202 Transcriptional misregulation in cancer
    100914649 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100914649 (RXRB)
   05216 Thyroid cancer
    100914649 (RXRB)
   05222 Small cell lung cancer
    100914649 (RXRB)
   05223 Non-small cell lung cancer
    100914649 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100914649 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:shr03310]
    100914649 (RXRB)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100914649 (RXRB)
Nuclear receptors [BR:shr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100914649 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 100914649
NCBI-ProteinID: XP_012404417
Ensembl: ENSSHAG00000006089
LinkDB
Position
4
AA seq 461 aa
MGDSGRDCRSPDSSSLSSSPQPPPRGGPPPSPGPPLAPLPSAASSLLGTGGPSQLPLGSP
FPVISSSMGSPGLPPPAPPGPYGPVSSPQINSTVSLPGGGSGTPEDVKPPLLGVRGLHCP
PPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKR
QRNRCQYCRYQKCLATGMKREAVQEERQRGKEKDGEGEGAGGAPEEMPVDRILEAELAVE
QKSDQGVEGPGGAGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILL
RAGWNELLIASFSHRSISVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMR
MDKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLESYCKQKYPEQQGRFAKLLLR
LPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgggcgacagcgggcgggactgtagaagcccagacagctcctccctgagctcgtcccca
cagcctcctccccgggggggccctcccccttctcctgggccccccctggctcccctaccc
tctgcagcttcatcccttctaggaacaggaggcccatcccaactcccacttggctccccc
ttccctgtcatcagctcctcaatggggtcgcctgggctgcctcccccagcccctcctgga
ccctatggccctgtcagcagtccccagattaactccacagtgtcactccctgggggaggg
tccggaaccccagaagatgtgaagccaccattgttgggtgttcgaggcctacactgtcca
cctcccccaggaggtccaggggctggcaaacgtctttgtgcaatctgtggggacaggagt
tcaggcaaacactatggggtctacagctgtgaaggttgtaaaggtttcttcaaacgaacc
atccgaaaggacttgacctactcatgtcgggacaacaaggattgcactgtggacaagcgg
caacggaaccgctgtcagtattgccgctaccagaaatgccttgccactggcatgaagagg
gaggcggtacaggaggaacgtcaaaggggcaaggagaaggacggggaaggggagggggcc
gggggggcccctgaggagatgcctgtggacaggatcctggaggctgaactcgccgtggag
cagaagagtgaccagggcgtagaagggcccgggggggccgggggcggcggcagtagccca
aatgaccctgtgaccaacatctgtcaggcagcagacaaacagctgtttacattggttgag
tgggcaaagaggatcccacacttctcctctctgcctctggatgaccaggtcatcttactt
cgagcaggctggaatgagctgctcatcgcttccttctcccatcgttccatctccgtcagg
gatggcattcttcttgccacaggactccatgttcatcgaaactctgctcattcagctggt
gttggagccatttttgatcgggtgctgactgaactggtgtccaagatgcgtgatatgcga
atggataagacagaacttggctgtctgagggcaattatcttattcaatccagatgccaag
ggcctctccaaccctggagaggtagagattctgagagagaaagtctatgcatctttggag
tcatactgtaaacagaaataccctgagcagcagggacggtttgcaaagctgctccttcgc
ctccctgccctccgctctattggcctcaagtgcttggagcatctgtttttcttcaagctc
atcggggacacgcccattgataccttcctcatggagatgctagaggcaccacaccagctt
gcctaa

DBGET integrated database retrieval system