KEGG   Sarcophilus harrisii (Tasmanian devil): 100914678
Entry
100914678         CDS       T02286                                 

Gene name
ELK1
Definition
(RefSeq) ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04510  Focal adhesion
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04921  Oxytocin signaling pathway
shr05140  Leishmaniasis
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05213  Endometrial cancer
shr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100914678 (ELK1)
   04012 ErbB signaling pathway
    100914678 (ELK1)
   04014 Ras signaling pathway
    100914678 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100914678 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100914678 (ELK1)
   04912 GnRH signaling pathway
    100914678 (ELK1)
   04921 Oxytocin signaling pathway
    100914678 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914678 (ELK1)
   05205 Proteoglycans in cancer
    100914678 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100914678 (ELK1)
   05213 Endometrial cancer
    100914678 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100914678 (ELK1)
   05161 Hepatitis B
    100914678 (ELK1)
   05163 Human cytomegalovirus infection
    100914678 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100914678 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100914678 (ELK1)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100914678 (ELK1)
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 100914678
NCBI-ProteinID: XP_031801060
LinkDB
Position
X
AA seq 361 aa
MDPSVTLWQFLLQLLKEQSNGHLIAWTSSDGEFKLVDAEEVARLWGLRKNKTNMNYDKLS
RALRYYYDKNIIRKVSGQKFVYKFVSFPEGPGHDGEEGQARAEIPSEPLRPLKASLGSIG
SSAPTPVRSSRNEYMRSGLYSTFTIQSLQQLSPARPARPVPEPLSPVGLEAPEARVPLQV
ILMAPAEGLTETVEPEASAATASLLLASETKGERPVEEGAAVAMETGVEVADPPGPAPAP
APAAEAHPPAPSKGRKPRDLELPLGPSPESAAVSGLGPALTPSLLTSHALTPVLLTPSAL
PPSIHFWSTLSPIAPRSPARLSFQFPASSSSSSSQAHVSVPTLSMDGLSTPVVLSPGPQK
P
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggacccatctgtgaccctgtggcagttcctgctgcaactgttgaaggagcagagtaac
gggcacttaatagcttggacgtccagcgatggggaattcaagctggtagacgccgaggag
gtggcacggctctgggggcttcgcaagaacaagaccaacatgaactacgacaagctgagc
agggccctgcggtactactacgacaagaatatcatccgtaaggtgagtgggcagaagttc
gtctacaaattcgtgtccttcccggaggggccgggccacgatggggaggagggccaggcc
cgggctgagatcccttcggagcccctccggccgctgaaggcctctctagggagcattggc
tcctccgccccgacccctgtgcgcagcagccggaatgagtacatgcgttctgggctctac
tccaccttcaccatccagtccctgcagcagctaagtcccgcccggcccgcccggcccgtc
ccggagcccctgagcccagtcggccttgaggccccggaagcccgagtgcctctgcaggtc
atcttgatggccccggccgaaggtctgaccgagaccgtggagcccgaggcttcggccgca
accgcctctttgcttctggcgtccgagacgaagggggagcggcctgtggaggagggggct
gctgtcgccatggagactggcgtggaggtcgccgaccccccgggccccgcccccgcgccg
gcccccgcagccgaggcccacccccccgccccttccaagggtcgcaaaccacgcgatctg
gagttgccgctggggccgagccccgagtcggccgcggtttccggcctgggcccggccctc
actccctccctgctcacctcccacgccctgaccccggtgcttctgacgcccagtgcgctg
ccccccagcatccacttctggagcaccctgagccccatcgcgccccgcagccctgcccgc
ctctccttccagttcccggccagcagcagcagcagcagctcccaggcacatgtgtctgtc
cccacactcagcatggacggcctctccacccccgtggtcctctccccaggtccccagaag
ccatga

DBGET integrated database retrieval system