KEGG   Sarcophilus harrisii (Tasmanian devil): 100914681
Entry
100914681         CDS       T02286                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04060  Cytokine-cytokine receptor interaction
shr04151  PI3K-Akt signaling pathway
shr04630  JAK-STAT signaling pathway
shr04640  Hematopoietic cell lineage
shr04657  IL-17 signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04672  Intestinal immune network for IgA production
shr05140  Leishmaniasis
shr05200  Pathways in cancer
shr05310  Asthma
shr05320  Autoimmune thyroid disease
shr05321  Inflammatory bowel disease
shr05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100914681 (IL4)
   04151 PI3K-Akt signaling pathway
    100914681 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100914681 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100914681 (IL4)
   04660 T cell receptor signaling pathway
    100914681 (IL4)
   04658 Th1 and Th2 cell differentiation
    100914681 (IL4)
   04659 Th17 cell differentiation
    100914681 (IL4)
   04657 IL-17 signaling pathway
    100914681 (IL4)
   04664 Fc epsilon RI signaling pathway
    100914681 (IL4)
   04672 Intestinal immune network for IgA production
    100914681 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914681 (IL4)
  09163 Immune disease
   05310 Asthma
    100914681 (IL4)
   05320 Autoimmune thyroid disease
    100914681 (IL4)
   05321 Inflammatory bowel disease
    100914681 (IL4)
   05330 Allograft rejection
    100914681 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100914681 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100914681 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100914681 (IL4)
Cytokines and growth factors [BR:shr04052]
 Cytokines
  Interleukins
   100914681 (IL4)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Haparin
  Cytokines
   100914681 (IL4)
SSDB
Motif
Pfam: IL4 DUF4474
Other DBs
NCBI-GeneID: 100914681
NCBI-ProteinID: XP_003756539
Ensembl: ENSSHAG00000011839
LinkDB
Position
2
AA seq 156 aa
MGLTFQLIPTLFCLLTCTSGVVHGQRRNCRSTVREIILSASSLTTKKFLCSEMEVLDIFE
DTKNSSTRKLLPEMSSCSQLAMTVNDFETLCRAVTVLQQASNSCPRQELKKMCRNLMHLV
NQTKCPVNETKITKLQDFLSKLKTINQKIFSKSTQF
NT seq 471 nt   +upstreamnt  +downstreamnt
atgggtctcacattccaactgataccaactttgttctgcctgttaacatgtactagtggt
gttgtccacggacagagaagaaactgccgaagcacggttagagagatcatcctctctgcg
agctctctcaccacgaaaaagtttctctgctctgagatggaagtgctagacatctttgag
gatacaaagaattccagtactcgaaagttgttacctgagatgtcctcatgttctcagctg
gccatgacagtgaatgactttgaaacactatgcagagctgtcactgtgcttcaacaggcc
tccaacagctgtccaagacaagagctaaagaaaatgtgtagaaacctaatgcatttagtg
aatcagaccaaatgtcctgtgaatgaaaccaagattactaaattgcaagatttcctgagc
aaactaaaaaccatcaatcagaagatattttcaaaaagcacacaattttag

DBGET integrated database retrieval system