KEGG   Sarcophilus harrisii (Tasmanian devil): 100914727
Entry
100914727         CDS       T02286                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04020  Calcium signaling pathway
shr04066  HIF-1 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04520  Adherens junction
shr04530  Tight junction
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05215  Prostate cancer
shr05219  Bladder cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100914727 (ERBB2)
   04012 ErbB signaling pathway
    100914727 (ERBB2)
   04066 HIF-1 signaling pathway
    100914727 (ERBB2)
   04020 Calcium signaling pathway
    100914727 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100914727 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100914727 (ERBB2)
   04520 Adherens junction
    100914727 (ERBB2)
   04530 Tight junction
    100914727 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914727 (ERBB2)
   05206 MicroRNAs in cancer
    100914727 (ERBB2)
   05205 Proteoglycans in cancer
    100914727 (ERBB2)
   05230 Central carbon metabolism in cancer
    100914727 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100914727 (ERBB2)
   05226 Gastric cancer
    100914727 (ERBB2)
   05219 Bladder cancer
    100914727 (ERBB2)
   05215 Prostate cancer
    100914727 (ERBB2)
   05213 Endometrial cancer
    100914727 (ERBB2)
   05224 Breast cancer
    100914727 (ERBB2)
   05223 Non-small cell lung cancer
    100914727 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100914727 (ERBB2)
   01524 Platinum drug resistance
    100914727 (ERBB2)
   01522 Endocrine resistance
    100914727 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100914727 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100914727 (ERBB2)
   04090 CD molecules [BR:shr04090]
    100914727 (ERBB2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100914727 (ERBB2)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100914727 (ERBB2)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100914727 (ERBB2)
CD molecules [BR:shr04090]
 Proteins
  100914727 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH PTP_tm
Other DBs
NCBI-GeneID: 100914727
NCBI-ProteinID: XP_012403823
Ensembl: ENSSHAG00000015078
UniProt: G3WQQ2
LinkDB
Position
4
AA seq 1255 aa
MDLPGCCCWGLLLVLLPPAVWGTQVCTGTDMKLQYPASIENHLDTLSHLYQGCQVVQGNL
ELTYLPADANLSFLQDIQEVQGYVLIAHSLVRSFPLQRLRIIRGTQLFEDKYALVVLDNG
IPLGTAPPTAEGPPGLRELQLRSLTEILKGGVLIQKNPQLCHQDTVLWADIFHKNNRLGT
TSIDTNHSRTCNPCSSSCKSGQCWGEGHDNCQNLTRTICASGCARCKGPLPTDCCHEQCA
AGCTGPKHSDCLACLHFNHSGICEQHCPPLVIYNSDTFESMPNPDGRYTFGSSCVKSCPY
NYLATDVGSTSCTLVCPLHSQEVTAEDGTHRCEKCSKACPKVCYGLGMGHLRSVRAVNST
NIQDFAGCKKIFGSLAFFPETFSGDLATNTSPLMPEDLKVFENLEEITGYLYISAWPDSL
PDLSIFQNLRVIRGRVLHNGVYSLTLEHLGIGWLGLRSLRELGSGLALIHHNAHLCFVHT
VPWNQLFRNPRQALLYSANRPAQECESKGLTCYSLCAQGHCWGPGPTQCLNCSQFLRGQE
CVEECRVLQGYPREYVKERRCFPCHEECQPQNGTETCFGSEADKCVACVHFKDPPSCVAR
CPSGVKPDLSFIPIWKYPDDEGICQTCPTNCTHSCTVLDEKGCPAEQKPSPVTSIIAGVV
GVLLALIIGLIIGILIKRRKQKERKHTMRRLLQETELVEPLTPSGALPNQAQMRILKETE
LRKVKVLGSGAFGTVYKGIWIPDGESVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGS
PYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLCSQDLLNWCVQIAKGMNYLEEV
RLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILCRRF
THQSDVWSYGVTVWELMTFGAKPYEGIPAREIPDLLEKGDRLPQPPVCTIDVYMIMVKCW
MIDSECRPRFRELVTEFSRMARDPQRFVVIQNEDSGPASPLDSTFYRSLLEEDDMSDLVD
AEEYLVPQQGFFCPDPPLAPGPGGTAHRRHRSSSTRSGGELPGGLEGAEEDPPQSSAEPW
EATGSDVFDGDPGGSPKGLKGLPPRDLSPLQRYSEDPTGPLTPEMDGYIVPPVCGPLPEY
VNQPEVHLPPSSPREGTLTPPHPSNSTLERPKLPPPGKNGVVKDTFTFGAAVENPEYLAP
HGGGPLHLPPTFSSPAFDNLYYWDQDPPDRGAAPNGFAGTPTAENPEYLGLDMPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggacctgcccggctgctgctgttgggggctccttctggtcctcctgcccccagcagtc
tggggaacccaagtgtgcacaggcacagacatgaagctgcagtatcctgccagtatcgag
aatcaccttgacacactgagccacctgtaccaaggatgccaggttgtacagggcaatctg
gagctcacttacctgcctgctgatgccaacctctccttcctccaggacatccaggaagtg
cagggatatgtgctgattgctcacagcctggtgaggagtttcccactgcagaggctaaga
atcattcgaggaacgcagctctttgaagacaaatatgccctagtcgttctggacaacggg
attccccttgggaccgctcctcctacagcggaggggccccctggccttcgggaactgcaa
cttcgaagcctcacagagattctgaaaggcggggttctgatccagaagaatcctcagcta
tgtcaccaagacacagtgttgtgggctgacatcttccataagaacaaccgcttgggtacc
acctccatcgacacaaaccacagccgaacttgcaacccttgctcttcatcatgtaaatcc
ggacagtgttggggagaaggacacgacaactgtcagaacttgacccgcacaatttgtgcc
agtggctgtgctcgctgcaaggggcccctccccacagactgctgccacgagcagtgtgct
gctggctgcactggccccaagcattctgactgcctggcctgcctccacttcaaccacagt
ggcatctgtgagcagcactgcccaccgctggtgatctacaattcagacacctttgagtca
atgcctaatcctgatgggcgctacacctttgggtccagttgtgtgaaatcatgtccctat
aattacctagccacagatgtgggctctacatcctgtaccctcgtgtgtcccctacacagt
caagaggtgaccgctgaggacggaacccatcggtgtgagaagtgcagcaaagcctgcccc
aaagtgtgttatgggctgggcatgggccacttgagatcagtgagagcggtcaacagcact
aatatccaggattttgcgggctgcaagaagatctttggaagtctggccttcttccccgag
accttctctggggacttggctaccaatacttctccattaatgcccgaagacctcaaggtc
tttgagaacctggaggagattacaggctatctgtacatctcggcctggcccgacagcctc
cctgatctcagcatctttcagaacctcagggtgatcaggggaagggtgttgcacaatggt
gtctactccctgacgctggagcatctgggtattggctggctggggctgcggtcactgaga
gagctgggcagtgggctggcactcatccatcacaatgcccacctatgctttgtccacacg
gtaccttggaaccaactcttccgcaacccccgccaggccctgctctacagcgccaaccga
cctgcccaggagtgtgaaagcaaggggctcacgtgctactccctgtgtgcccaggggcac
tgctggggccctgggcctacccagtgtctcaactgcagccagtttctccgagggcaggag
tgtgtggaggagtgccgggtcctgcaggggtacccccgggagtatgtaaaggagagacgc
tgtttcccgtgccatgaggagtgccagccccagaatggcacagaaacctgctttggatcg
gaggctgacaaatgtgtagcctgtgtccacttcaaggaccccccttcctgcgtggcccga
tgccccagtggggtgaagcccgacctctccttcatacccatctggaagtatccagatgat
gagggcatttgccagacctgccccaccaactgtacccactcctgtactgtattggatgaa
aaaggctgtcctgctgagcagaaacccagccccgtgacctccatcattgctggggtggtt
ggggtgcttctagccctcatcataggcctgatcattggcatcttgattaagcgtcggaaa
cagaaggaacggaagcacaccatgaggaggctgcttcaggagacagagctggtggagccc
ttgacgcccagcggagcgctgcccaaccaagcgcagatgcgaatcctaaaagagacagag
ctgaggaaagtgaaggttcttggctctggggccttcggcacagtctacaagggtatttgg
atccctgatggtgaaagtgtgaaaatccccgtggctatcaaggtgttgagggaaaacaca
tcccccaaagccaacaaggagatcttggatgaagcatacgtgatggcaggggtcggctcg
ccgtatgtgtctcgccttctgggcatctgcctgacatccacagtgcagctagtgacccag
ctgatgccctatggctgcctcctggaccacgttcgggaaaatcgagggcggctctgctcc
caggacctcctcaactggtgtgtgcagattgccaaggggatgaactacctggaggaggtt
cggctagtgcacagagacctggctgccagaaatgtgctggtcaagagtcccaaccacgtc
aagatcacagacttcggactggccaggctcttggacatcgatgagacagagtaccacgca
gatgggggcaaggtccccatcaagtggatggccctggagtccattctctgccggagattc
acccatcagagcgatgtgtggagctacggggtgacagtgtgggaactgatgacctttggg
gccaaaccatatgaggggattccagctcgagagattccggacctgctggagaagggggac
cggctgcctcagccccctgtctgcaccatcgatgtctacatgatcatggttaaatgttgg
atgattgactctgagtgtcggcctcggttccgggaactggttactgaattttcacgaatg
gcccgagaccctcagcgctttgtggtcattcagaatgaggattctggcccagccagcccc
ctggacagcactttctaccgctcactgttggaggaagacgacatgagtgacttagtggat
gcagaagaatacctggtgccccagcaaggcttcttctgccctgaccctcccttggctcca
gggcctggaggcactgcccatcgaaggcacagaagttcttctacgaggagtggtggggag
cttccaggaggactggaaggtgctgaagaggaccctccacaatcttcagcagaaccttgg
gaagcaactggttctgatgtgtttgatggggaccctggagggagccctaagggactaaag
ggactcccccctagagacctcagccccctgcagcgctacagtgaggatccgacaggacca
ctgacccctgagatggatggctatattgtcccacccgtctgtggccccctgcctgaatac
gtgaaccagccagaggtgcacctaccaccctcttctccccgggaggggaccctgactccc
cctcacccatccaactccaccttggaacgtcccaagttgcctcctccagggaagaatgga
gtggtcaaagacacatttacctttggcgcagctgtggagaaccccgagtacttggccccc
catggtgggggtccccttcatcttcctccaactttctccagcccagcctttgacaacctc
tactactgggaccaggatccccctgatcgaggagctgcccctaatggctttgcagggacc
cccacagccgagaaccctgagtacttgggtttggatatgcctgtgtga

DBGET integrated database retrieval system