KEGG   Sarcophilus harrisii (Tasmanian devil): 100914800
Entry
100914800         CDS       T02286                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3 isoform X1
  KO
K17448  SHC-transforming protein 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04510  Focal adhesion
shr04650  Natural killer cell mediated cytotoxicity
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr04935  Growth hormone synthesis, secretion and action
shr05034  Alcoholism
shr05100  Bacterial invasion of epithelial cells
shr05214  Glioma
shr05220  Chronic myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100914800 (SHC3)
   04014 Ras signaling pathway
    100914800 (SHC3)
   04072 Phospholipase D signaling pathway
    100914800 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100914800 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100914800 (SHC3)
   04062 Chemokine signaling pathway
    100914800 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100914800 (SHC3)
   04915 Estrogen signaling pathway
    100914800 (SHC3)
   04917 Prolactin signaling pathway
    100914800 (SHC3)
   04926 Relaxin signaling pathway
    100914800 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    100914800 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100914800 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100914800 (SHC3)
   05226 Gastric cancer
    100914800 (SHC3)
   05214 Glioma
    100914800 (SHC3)
   05220 Chronic myeloid leukemia
    100914800 (SHC3)
   05224 Breast cancer
    100914800 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100914800 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    100914800 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100914800 (SHC3)
   01522 Endocrine resistance
    100914800 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100914800
NCBI-ProteinID: XP_031795124
Ensembl: ENSSHAG00000001805
LinkDB
Position
1
AA seq 647 aa
MRQHTKYNRFRNDSVTSVDELIHNLSTNTCKVSTIATTSAISSSYVVSTQVLHKDQEDGS
TTLCTLKHKVSHLKFSSSSNLLGIKNLPSAVKDLAVSKLPGSLSVPSSASGASDNTCNLV
SATLCSQQNTSKMNTGKKIQSEEMHLGGEVCNSNSIFVNKPSGGWLHSNEKILGPGVTFE
VKYLGCLEVLRSMRSLDFSTRTQITRDMIFPLRTALAASQEFWEAISRVCEAVPGAKGGF
RKQKPPRKVLSNILGKSNLQFAGMTITLNISTTSLNLMTPDSKQIIANHHMQSISFASGG
DPDTTDYVAYVAKDPVNHRACHILECSDGLARDVISTIGQAFELRFKQYLQCPSKIPALH
DCRQSLDEPWMEEEGERTEHPYYNSIPNKVPHVGEFLDVRSKTRICTADTSKTSGREQTY
YQGRHLGGKFSDDWQHAPINQGSLDSYNMPEGKSQVTPVGETPIYVNTQGVNIQVLQALP
GDTGSVFSDSVDTTKDNSPRKDLFDMRPFEDALKNQTMEPLLNKAMSVENTSPILSRVPD
WRMMEELKAEPWYQGEMSRKEAEQLIKSDGDFLVRKSTTNPGSYVLTGMHNTQVKHLLLV
DPEGIVRTKDQVFDSISHLINHHLENNLPLISAGSELCLQQPVQRKQ
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgcgtcaacataccaagtataaccgcttcaggaatgattcagtgacatcagttgatgaa
cttatccacaatttgtccacgaatacctgcaaggtctcaacaattgccacaacttcagca
atatcatcctcctatgtggtctcaacccaggttctccataaagaccaggaggatggatcc
accacgctttgtactctcaaacataaagtatctcacttgaaattctccagctccagcaac
cttttgggcatcaaaaacctgccttctgcagtcaaggaccttgctgtttccaagttgcca
ggcagcttgagtgttcctagctcagcatcaggcgcttcagacaacacatgtaaccttgtc
tctgccactctgtgttctcagcagaacacaagcaagatgaacacagggaaaaaaattcag
tcagaggagatgcacctaggaggtgaagtctgcaattcaaatagcatttttgtcaataag
ccttctggagggtggctgcattcaaatgaaaagatcctgggacctggtgtgacgtttgaa
gtgaagtatttgggctgcttagaagttttacgctcaatgaggtctcttgactttagtaca
agaactcaaattacaagggatatgatttttcccctgaggactgctttagctgcatcccag
gaattttgggaagcaatcagccgtgtttgtgaagcagtacctggtgccaaaggaggtttc
agaaaacaaaagccaccacggaaagtcttatccaacattctgggaaagagcaatcttcaa
tttgcagggatgaccataaccttgaatatatctaccactagcctaaacctaatgacacct
gattcaaaacagattatagcaaatcatcacatgcaatctatttcctttgcttctggaggt
gatccggatacaacagattatgttgcatatgtagctaaggatcctgttaatcatagagct
tgtcacatactggaatgctctgatggcttggctcgagatgttatcagtactataggtcaa
gcttttgagcttcgattcaagcagtatttacaatgtccttcaaagatacctgctcttcat
gactgcaggcaaagtctggatgagccatggatggaagaagagggagaaagaacagaacat
ccatattataacagcattcccaacaaagtgccccatgtgggagagtttcttgatgttaga
tcaaaaaccagaatttgtactgctgacacaagcaagacttcaggaagagagcaaacttac
taccagggacggcacttaggaggcaaattcagtgatgattggcagcatgcacctattaat
caaggttctttggatagctataacatgccagaaggaaaatcccaagtaactcctgtaggg
gagacaccaatctatgtgaatactcaaggtgtaaatattcaagttttgcaagcccttcca
ggagacactggaagtgtattcagtgactcagtggacactaccaaagacaatagcccaaga
aaagacttatttgacatgagaccttttgaagatgctctcaagaaccaaactatggaacct
ttgttaaataaggctatgtcagtggaaaacaccagccctattttatccagagtacctgat
tggagaatgatggaagagttaaaggcagaaccttggtatcaaggagaaatgagcaggaaa
gaggcagagcagctaataaaaagtgatggggactttcttgtcaggaaaagcaccaccaat
ccaggatcctatgtcctgacagggatgcataatacccaagtcaagcatcttcttttagtt
gacccagaaggaattgttcgaacaaaggaccaagtttttgacagcataagtcacctcatc
aaccatcatcttgagaataatttgcccctaatatcagctgggagtgaactctgccttcaa
cagcctgtgcaaaggaaacagtga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100917745
Entry
100917745         CDS       T02286                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2 isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04370  VEGF signaling pathway
shr04510  Focal adhesion
shr04650  Natural killer cell mediated cytotoxicity
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr04935  Growth hormone synthesis, secretion and action
shr05034  Alcoholism
shr05100  Bacterial invasion of epithelial cells
shr05214  Glioma
shr05220  Chronic myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100917745 (SHC2)
   04014 Ras signaling pathway
    100917745 (SHC2)
   04370 VEGF signaling pathway
    100917745 (SHC2)
   04072 Phospholipase D signaling pathway
    100917745 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100917745 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100917745 (SHC2)
   04062 Chemokine signaling pathway
    100917745 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100917745 (SHC2)
   04915 Estrogen signaling pathway
    100917745 (SHC2)
   04917 Prolactin signaling pathway
    100917745 (SHC2)
   04926 Relaxin signaling pathway
    100917745 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    100917745 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100917745 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100917745 (SHC2)
   05226 Gastric cancer
    100917745 (SHC2)
   05214 Glioma
    100917745 (SHC2)
   05220 Chronic myeloid leukemia
    100917745 (SHC2)
   05224 Breast cancer
    100917745 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100917745 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    100917745 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100917745 (SHC2)
   01522 Endocrine resistance
    100917745 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100917745
NCBI-ProteinID: XP_031804118
Ensembl: ENSSHAG00000011421
LinkDB
Position
1
AA seq 619 aa
MSSRAGPGPGPGAPSSPPPASPATPRPGSEAGLDEPDAPTTFCKLLPRMSPWKFAGPAAF
LSRSPSSAGKELAPASATKGGGLEEVSAPGSGTGPGLAAVLGACEPVCASPCSLQLMSRC
RGTSGARQAGAAAGARGVGSGARPPLAGDEWSRKGSFIHKPPQGWLHPDDRVLGPGVSYI
VRYMGCIEVLRSMRSLDFNTRTQVTREAINRLYEAVPGVRGAWKKKAPNKALFSILGKSN
LRFAGMSITINISIDGLNLMVPTTRQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQ
RACHILECCEGLAQNVISTVGQAFELRFKQYLYSPPKVAIPPERMMGNEESTWGEEEDIT
EHDYYNSIPGKEPPLGGLVDSRLWAPSYIHTQPPSSGAFSQLGSPARREQRSQAGLHWDL
GLPGQPCDDGYLQADSRPLGSRDYEEHMYVNTQNLESWETEPAAPEESPKKDLFDMRPFE
DALKLHECSVASSGPVPIEDQWPSPPTRRAPIAPTEEQLRQEPWYHGKMSRRAAEKLLRT
DGDFLVRDSVTNPGQYVLTGMHGGQPKHLLLVDPEGVVRTKDVLFESISHLIDYHLQNGQ
PILAAESELHLRDVVKREP
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgagcagccgggcaggcccgggccccggccccggcgccccgtcttctcccccgcccgcc
tccccggccaccccgaggcccgggtccgaggccgggctggacgagccagatgcccccacc
actttctgtaagctcctgcccaggatgtctccatggaagttcgcgggccccgccgccttt
ctcagccgcagcccctccagcgcgggcaaggagctggccccagcatcggccaccaagggc
ggcggcctggaggaggtgtccgctccgggatccgggactgggcccggcctggccgcggtg
ctgggcgcctgcgaacccgtgtgcgccagcccctgctctttgcagctgatgagccgctgc
cgaggcacgagcggggcccgccaggccggggctgcggccggagcgcggggagttgggtcc
ggggcgcgaccaccgctggccggcgacgagtggagtcgcaaaggcagttttatccacaag
cccccgcagggctggctgcacccggacgacagggtcctggggcccggggtctcctacatc
gtgcggtacatgggctgcatagaggtactacgttccatgaggtccttggattttaacacc
cggacccaggttacccgggaggcgatcaataggctttacgaagcagtgcctggtgtccga
ggtgcctggaagaaaaaggcccccaacaaagcccttttctccatccttgggaagagcaac
ctccgtttcgctggtatgagtattacaatcaacatctccatcgatgggctcaaccttatg
gtgcccaccactcgccagatcatcgctaaccatcacatgcagtccatctccttcgcctcc
ggtggcgacacggacatgaccgattacgtggcctatgtggcaaaagatcccattaaccag
agagcctgtcacatcctggagtgctgtgaaggattagcccagaatgtcatcagcactgtg
ggccaggccttcgagctgcgcttcaaacaatatctctacagcccccccaaagtggccatt
ccccccgaaaggatgatggggaacgaggagtcaacttggggtgaggaggaggatattacc
gaacatgactattataacagcatccctgggaaggagccccccctgggcggtctggtggac
tcccgcctctgggcgcccagctacatccacacccagccccctagctcgggggctttcagc
cagcttggatccccggcccggagagagcaacggagtcaggctggcctgcactgggacctg
ggtctccctggccagccctgtgatgatggctacctgcaggcagacagccggcctctgggc
tcccgggactatgaggagcacatgtatgtgaacacccagaacctggagagctgggagact
gagcctgcagccccggaggagagccctaagaaggacctttttgatatgaggccctttgaa
gatgccctgaaacttcacgagtgttccgtggccagcagcgggcctgtccccatcgaagac
cagtggcccagccctcccactcgccgggctcccattgccccaacagaggagcagctccgt
caagaaccctggtaccacggcaagatgagccggcgggcagccgaaaaattgctcaggaca
gatggggacttcctggtgcgggacagcgtcactaaccccgggcagtatgtcctaacgggc
atgcacgggggtcagcccaagcacctgctcctggtggaccccgagggcgtggtacggacc
aaggatgtgctgtttgagagcatcagccaccttattgattaccatctgcaaaatgggcag
cccatcctggccgctgagagtgaactgcacctgcgggacgtggtgaagcgagaaccctga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926921
Entry
100926921         CDS       T02286                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X4
  KO
K06279  SHC-transforming protein 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04510  Focal adhesion
shr04650  Natural killer cell mediated cytotoxicity
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr04935  Growth hormone synthesis, secretion and action
shr05034  Alcoholism
shr05100  Bacterial invasion of epithelial cells
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05220  Chronic myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100926921 (SHC1)
   04014 Ras signaling pathway
    100926921 (SHC1)
   04072 Phospholipase D signaling pathway
    100926921 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100926921 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100926921 (SHC1)
   04062 Chemokine signaling pathway
    100926921 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100926921 (SHC1)
   04915 Estrogen signaling pathway
    100926921 (SHC1)
   04917 Prolactin signaling pathway
    100926921 (SHC1)
   04926 Relaxin signaling pathway
    100926921 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    100926921 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100926921 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100926921 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100926921 (SHC1)
   05226 Gastric cancer
    100926921 (SHC1)
   05214 Glioma
    100926921 (SHC1)
   05220 Chronic myeloid leukemia
    100926921 (SHC1)
   05224 Breast cancer
    100926921 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100926921 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100926921 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100926921 (SHC1)
   01522 Endocrine resistance
    100926921 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100926921
NCBI-ProteinID: XP_003768105
Ensembl: ENSSHAG00000004522
LinkDB
Position
4
AA seq 459 aa
MNKLSGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNEKVMGPGVSYLVRYMGCVEV
LQSMRALDFSTRTQVTREAISLVCEAVPGAKGAARRRKPCSRPLSSILGRSNLKFAGMPI
TLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILEC
PEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYND
FPGKEPPLGGVVDMRLPRPAPPSTQAASHLGATLPVGQIAGSDFEGRKQLPTPGPGRELF
DDPSYVNVQNLEKVRQGAGVSSNPTTNGSAPRDLFDMKPFEDALRVPPPAPTTAMAEQLR
GEPWFHGKLSRREAEGQLRINGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRT
KDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgaacaaactgagcggcgggcggaggactcgggtggaagggggccagctggggggtgag
gagtggactcgtcacgggagctttgtcaacaagccaactcggggttggttgcatcccaac
gaaaaggtcatgggacctggagtttcctatcttgttcggtacatgggttgtgtggaggtc
ctccagtcaatgcgggctttggatttcagtactcgtacccaggtcaccagggaagccatc
agtctggtgtgtgaggctgtgcctggggctaagggggctgcacggaggagaaagccctgt
agccgcccactcagctccatactggggaggagtaatctaaagtttgctggcatgcccatt
accctaactgtttctaccagcagcctcaacctcatggctgcagactgtaaacagatcatt
gccaatcaccacatgcagtcaatctcatttgcatccggtggagatccggatactgcagag
tatgttgcctatgttgccaaagatcctgtcaatcagagagcctgccacatcctggagtgt
ccagaaggactagcacaggatgtcatcagcaccattggccaggcctttgagctgcgcttc
aaacagtacctcaggaacccacccaagcttgtcactccccatgacaggatggctggcttt
gatggctcagcttgggatgaggaggaagaagagccccctgatcatcagtactacaatgac
ttcccagggaaggagccccctcttgggggagtggtagacatgagacttcctcgtccagcc
ccccccagcactcaggctgccagccacctaggagccactttgcccgttggacagatcgct
ggcagtgactttgagggccggaaacagctccctactcctgggccaggtagagaattattt
gatgatccctcctatgtcaatgtccagaacctggaaaaagtccggcaaggagctggtgtt
tcttccaaccctactaccaatggcagtgccccacgtgacctttttgacatgaagccattt
gaagatgcgcttcgggtccccccacctgcccctacaacagcaatggcggagcagctccga
ggggagccttggttccatgggaagttgagtaggcgggaggctgaagggcagctgaggatc
aatggggattttctggttcgagagagtacaaccaccccaggccagtatgtccttactggc
ctgcagagtggccagcccaaacatttgctgcttgttgatcctgaaggcgtggttcggaca
aaggatcaccgattcgaaagtgtcagtcacctcatcagctaccacatggacaatcaccta
ccaatcatctctgcagggagcgagctatgtcttcagcaaccagtagaacggaagctataa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100927458
Entry
100927458         CDS       T02286                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4 isoform X1
  KO
K17449  SHC-transforming protein 4
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04072  Phospholipase D signaling pathway
shr04510  Focal adhesion
shr04650  Natural killer cell mediated cytotoxicity
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr04935  Growth hormone synthesis, secretion and action
shr05034  Alcoholism
shr05100  Bacterial invasion of epithelial cells
shr05206  MicroRNAs in cancer
shr05214  Glioma
shr05220  Chronic myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100927458 (SHC4)
   04014 Ras signaling pathway
    100927458 (SHC4)
   04072 Phospholipase D signaling pathway
    100927458 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100927458 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100927458 (SHC4)
   04062 Chemokine signaling pathway
    100927458 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100927458 (SHC4)
   04915 Estrogen signaling pathway
    100927458 (SHC4)
   04917 Prolactin signaling pathway
    100927458 (SHC4)
   04926 Relaxin signaling pathway
    100927458 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    100927458 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100927458 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100927458 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100927458 (SHC4)
   05226 Gastric cancer
    100927458 (SHC4)
   05214 Glioma
    100927458 (SHC4)
   05220 Chronic myeloid leukemia
    100927458 (SHC4)
   05224 Breast cancer
    100927458 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100927458 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    100927458 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100927458 (SHC4)
   01522 Endocrine resistance
    100927458 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100927458
NCBI-ProteinID: XP_003755972
Ensembl: ENSSHAG00000015404
LinkDB
Position
2
AA seq 626 aa
MRGRSPESLSGHVLYVGLFGYPGMLHRAKYSRFRNEPITSLDEGSSGGSSVNVKGVPQTS
PSSPLPAHLPGEDVTLAAQDNPTPLCTLMPRMASLRLANPANLLGLKNFCLGTREVPKLK
LLESRGAAPSSPTSPEASLSRATSASSPRLDVQNEDNCILPTLEAPPSGSNQDGSSHRHL
LGTGMNYCVKYIGCVEVLQSMRSLDFGMRTQVTREAISRLCEAVPGENGPIKRRKPPVKF
LSSVLGRSNLQFSGINIKLTISTCSLTLTNIETQQIIANHHMQSISFASGGDPDTTDYVA
YVAKDPVNQRACHILECPSGMAQDVINTIGQAFELRFKEYLKNPSSLNIPSEREEVNIED
NTEEKEEHEYYNEIPGKQPPAGGVLDARMKVQTTEQRTYCPIQCEKLCCSPRNPKCSSVY
ENCLEPSRAIGSISERVVKTQRDPSLTKHRCRVDLFDDPCYINTQAFQTAVCPSGNQDPA
QILGSPLHCAKIPETVQPSATSRTAGLYALPQIKRQLKNEDCYHGKLSRKAAESLLIKDG
DFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMENSLPI
ISSGSEVSLRQPVRKENQKGHFQPYK
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgagaggacgcagtccggagagcctcagtggacacgtactgtatgtaggactctttggg
taccccgggatgctgcacagggccaagtatagtcgttttcggaatgagcccatcacttcc
ttagatgaagggtcttctggaggttcttcagtcaatgtcaaaggcgtacctcagacttct
ccttcttcccccttgccagctcacctgcctggggaagatgtcaccttggcggctcaggat
aaccccaccccactgtgcactttgatgccccgaatggcaagtcttagactggccaatcca
gcaaacctactgggactgaaaaacttctgcctggggacccgtgaggtgcccaagctcaaa
ctgttggagagtcggggggcagctccgagcagcccaacttccccagaagccagcctttcc
cgggccacctctgcttcatctcctcggctggatgtacaaaatgaggataactgcatcctg
cccaccttggaggcaccaccttctgggagcaatcaggatgggtcctctcaccggcacctg
ctggggacaggcatgaactactgtgtaaagtacataggctgtgttgaagtgctgcagtcg
atgagatccttggattttggcatgagaacccaagttacaagggaagcaataagccgcctg
tgtgaggctgttcccggggaaaatggacccattaaaagacgcaagcctccagttaagttt
ttatcttctgtacttggcagaagtaaccttcagttttctggaattaatataaaactgacc
atctcaacatgtagccttactttgacgaacattgaaacccagcagattattgcaaatcat
cacatgcagtccatttcttttgcttctggaggtgatcctgacaccacagactatgttgcc
tacgtagctaaagatccagttaatcaaagagcctgccatattttggaatgtcccagtgga
atggctcaagatgtcataaataccatagggcaggcttttgaactccgatttaaagagtat
ttgaaaaatccttcttctttgaatattcccagtgaaagggaggaggtgaatattgaggac
aatacagaggaaaaagaagaacatgagtattacaatgaaattccaggaaagcagccacct
gctggtggtgttttagatgctcgaatgaaagttcagaccacagaacaaagaacttactgc
ccaatacaatgtgaaaagctatgctgttcaccccggaaccccaaatgcagcagcgtatat
gaaaattgcttagaacccagcagggcaataggtagtatcagtgaaagagttgtgaagact
caaagggatccatcattaacgaagcataggtgcagggtggatctcttcgatgatccctgc
tacatcaacactcaggcatttcagacggcagtctgcccttctggaaatcaagaccccgct
caaatacttgggagcccgttacactgtgcaaaaataccagaaacggttcaaccaagtgcc
acaagcaggacagctggtctctatgctttaccccaaatcaaaagacaattgaagaatgaa
gattgctaccatggaaaactaagtcggaaagcagcagaaagcctcttaattaaggatggg
gattttttggttcgagaaagtgcaacatcacctggtcaatatgtattgagtggcttacaa
ggaggtcaggcaaaacaccttctattggtggaccctgaaggcaaggtgaggaccaaagat
catgtatttgataatgtgggtcacctcattcgctatcacatggagaatagtctgccgatc
atctcttctggaagtgaagtaagccttagacagccagtaagaaaagagaatcaaaaaggc
catttccagccctacaaatga

DBGET integrated database retrieval system