KEGG   Sarcophilus harrisii (Tasmanian devil): 100914910
Entry
100914910         CDS       T02286                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 proprotein
  KO
K13376  transforming growth factor beta-2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04380  Osteoclast differentiation
shr04390  Hippo signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05144  Malaria
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05321  Inflammatory bowel disease
shr05323  Rheumatoid arthritis
shr05410  Hypertrophic cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100914910 (TGFB2)
   04350 TGF-beta signaling pathway
    100914910 (TGFB2)
   04390 Hippo signaling pathway
    100914910 (TGFB2)
   04068 FoxO signaling pathway
    100914910 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100914910 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100914910 (TGFB2)
   04218 Cellular senescence
    100914910 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100914910 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914910 (TGFB2)
   05206 MicroRNAs in cancer
    100914910 (TGFB2)
   05205 Proteoglycans in cancer
    100914910 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100914910 (TGFB2)
   05212 Pancreatic cancer
    100914910 (TGFB2)
   05225 Hepatocellular carcinoma
    100914910 (TGFB2)
   05226 Gastric cancer
    100914910 (TGFB2)
   05220 Chronic myeloid leukemia
    100914910 (TGFB2)
   05211 Renal cell carcinoma
    100914910 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100914910 (TGFB2)
   05161 Hepatitis B
    100914910 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100914910 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100914910 (TGFB2)
   05144 Malaria
    100914910 (TGFB2)
   05145 Toxoplasmosis
    100914910 (TGFB2)
   05140 Leishmaniasis
    100914910 (TGFB2)
   05142 Chagas disease
    100914910 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100914910 (TGFB2)
   05321 Inflammatory bowel disease
    100914910 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100914910 (TGFB2)
   05414 Dilated cardiomyopathy
    100914910 (TGFB2)
   05415 Diabetic cardiomyopathy
    100914910 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100914910 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100914910 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100914910 (TGFB2)
Cytokines and growth factors [BR:shr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100914910 (TGFB2)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100914910 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100914910
NCBI-ProteinID: XP_003767761
Ensembl: ENSSHAG00000017613
LinkDB
Position
4
AA seq 408 aa
MHYYLLSVFLTLDLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKANRRAAACERERSDEEYYAKEVYKIDMPYYSENAIPPTL
YRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVSEQRIELYQILKSKDLTSPTQ
RYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNK
SEELEARFAGIDGSFSDLKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSSRRKKRALDA
AYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSL
YNTINPEASASPCCVSQDLEPLTILYYVGKTPKIEQLSNMIVKSCKCS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcactattatctcctaagcgttttcctgaccctggatctggtcaccgtggcgctgagc
ctctctacctgcagcacactcgacatggatcagttcatgcgcaagaggatcgaggcgatt
cggggccagatcctcagcaagctgaagctcaccagcccccctgaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatttacaacagtaccagggacttgctccaggag
aaagccaaccggagggcagcagcttgcgagagggagaggagcgacgaggagtactatgcc
aaagaggtgtacaaaatagacatgccctactattcggaaaatgccatcccgcccactttg
tacaggccctactttagaattgtcagatttgatgtctcagcaatggagaagaatgcttcc
aacttggtgaaggcagagttcagggtctttcggctgcagaatcctaaggcccgggtgtct
gagcaacggattgagctctatcagattctcaaatccaaagacttaacatccccaacccag
cgttacattgatagcaaggttgttaagacaagagcagaaggggaatggctctcgtttgat
gtcaccgaagctgtgcatgaatggctacaccataaagacaggaacctgggatttaagata
agtttacactgtccatgctgcacttttgtaccatccaataattacatcatcccgaataaa
agtgaagaattagaagcaagatttgcaggtattgatggctccttcagtgatctgaaaact
ataaagtccactaggaaaaaaaacagtgggaagaccccacatctcctgctaatgttgtta
ccctcctacagacttgagtcgcaacagtccagccggcggaagaagcgtgctctagatgcc
gcctattgttttaggaatgtacaggataactgttgtctgcgcccactttatattgatttc
aagagagaccttggatggaaatggattcatgaacccaaagggtacaatgctaatttctgt
gctggtgcctgcccatatctatggagttcagatactcaacacagtagagttctcagttta
tataataccataaacccagaagcatcggcatctccttgctgtgtatcacaggatttggaa
cctctcaccatcctctactatgttggcaaaacacccaagattgaacagctttccaatatg
attgtcaaatcttgcaaatgcagctaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100929617
Entry
100929617         CDS       T02286                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 proprotein
  KO
K13377  transforming growth factor beta-3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04390  Hippo signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05144  Malaria
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05321  Inflammatory bowel disease
shr05323  Rheumatoid arthritis
shr05410  Hypertrophic cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100929617 (TGFB3)
   04350 TGF-beta signaling pathway
    100929617 (TGFB3)
   04390 Hippo signaling pathway
    100929617 (TGFB3)
   04068 FoxO signaling pathway
    100929617 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100929617 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100929617 (TGFB3)
   04218 Cellular senescence
    100929617 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929617 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100929617 (TGFB3)
   05212 Pancreatic cancer
    100929617 (TGFB3)
   05225 Hepatocellular carcinoma
    100929617 (TGFB3)
   05226 Gastric cancer
    100929617 (TGFB3)
   05220 Chronic myeloid leukemia
    100929617 (TGFB3)
   05211 Renal cell carcinoma
    100929617 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100929617 (TGFB3)
   05161 Hepatitis B
    100929617 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100929617 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100929617 (TGFB3)
   05144 Malaria
    100929617 (TGFB3)
   05145 Toxoplasmosis
    100929617 (TGFB3)
   05140 Leishmaniasis
    100929617 (TGFB3)
   05142 Chagas disease
    100929617 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100929617 (TGFB3)
   05321 Inflammatory bowel disease
    100929617 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100929617 (TGFB3)
   05414 Dilated cardiomyopathy
    100929617 (TGFB3)
   05415 Diabetic cardiomyopathy
    100929617 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100929617 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100929617 (TGFB3)
Cytokines and growth factors [BR:shr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100929617 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100929617
NCBI-ProteinID: XP_031808358
LinkDB
Position
2
AA seq 412 aa
MKMHLQRALVVLSLLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEAS
TLAHVPYHILALYNSTREMLEEMQEEKEESCTQENTESEYYAKEIHKFDMIQGLAEHNEL
SVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNLNSKRTEQRIELFQILRPDEHI
AKQRYISGKNLPTRGTAEWLSFDVTDTVREWLLHRESNLGLEISIHCPCHTFQPNGDILE
SIHEVMEIKFKGVDSDEDYGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctttcactgctgaactttgccacagtc
agtctctctctttccacttgtaccactttggactttggtcacatcaagaaaaagagagtg
gaagccattcggggacagatcttaagcaagctgcggctcaccagcccccctgaggcatca
accttggcccatgtgccctaccacatcctagccctctataacagcacccgggagatgctg
gaggagatgcaggaggagaaggaggagagctgcactcaggaaaacactgagtcggaatac
tatgccaaagaaatccataagttcgacatgatccaaggtcttgcagaacacaatgagctg
agtgtgtgtcccaaagggattacctccaaggttttccgcttcaatgtatcctcagtggaa
aagaatggaaccaacttattccgagctgaattccgagtcttgagggtgcccaacctcaac
tccaaacggacggagcagagaattgagctctttcagatcctgcgacctgatgagcacatc
gccaaacagcgctacatcagtgggaagaacctgcccactcggggcactgctgagtggctg
tcctttgacgtcactgacacggttcgggaatggcttctgcacagagaatccaacttgggg
ctggaaatcagcattcattgcccatgccataccttccaacccaatggagatatcttggag
agcattcacgaggtgatggagatcaaattcaaaggtgttgacagtgatgaagattatggg
cgtggagatcttgggcgactgaagaaacaaaaggatcaccacaatcctcatttgattttg
atgatgattcctccacatcgccttgacagtccaggccagggaggccaaaggaagaaacgg
gctcttgataccaactactgcttccggaatttggaggagaattgctgtgtgcgtcctctc
tacattgatttccgacaggatctgggctggaagtgggtccatgagcctaagggctactat
gccaacttctgctcaggtccttgcccatacctccgaagtgcagatacaacccacagcacg
gtgctgggactatataatactctgaatcctgaagcgtctgcttccccttgttgtgtgccc
caagatctggagcctctgaccatcctgtattatgttgggaggacccccaaagtggagcag
ctctccaacatggtggtgaagtcttgtaagtgcagctga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932607
Entry
100932607         CDS       T02286                                 

Gene name
TGFB1
Definition
(RefSeq) LOW QUALITY PROTEIN: transforming growth factor beta-1 proprotein
  KO
K13375  transforming growth factor beta-1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04060  Cytokine-cytokine receptor interaction
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04380  Osteoclast differentiation
shr04390  Hippo signaling pathway
shr04659  Th17 cell differentiation
shr04672  Intestinal immune network for IgA production
shr04926  Relaxin signaling pathway
shr04932  Non-alcoholic fatty liver disease
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05144  Malaria
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05321  Inflammatory bowel disease
shr05323  Rheumatoid arthritis
shr05410  Hypertrophic cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100932607 (TGFB1)
   04350 TGF-beta signaling pathway
    100932607 (TGFB1)
   04390 Hippo signaling pathway
    100932607 (TGFB1)
   04068 FoxO signaling pathway
    100932607 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100932607 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100932607 (TGFB1)
   04218 Cellular senescence
    100932607 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100932607 (TGFB1)
   04672 Intestinal immune network for IgA production
    100932607 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100932607 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100932607 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932607 (TGFB1)
   05205 Proteoglycans in cancer
    100932607 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100932607 (TGFB1)
   05212 Pancreatic cancer
    100932607 (TGFB1)
   05225 Hepatocellular carcinoma
    100932607 (TGFB1)
   05226 Gastric cancer
    100932607 (TGFB1)
   05220 Chronic myeloid leukemia
    100932607 (TGFB1)
   05211 Renal cell carcinoma
    100932607 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100932607 (TGFB1)
   05161 Hepatitis B
    100932607 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100932607 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100932607 (TGFB1)
   05144 Malaria
    100932607 (TGFB1)
   05145 Toxoplasmosis
    100932607 (TGFB1)
   05140 Leishmaniasis
    100932607 (TGFB1)
   05142 Chagas disease
    100932607 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100932607 (TGFB1)
   05321 Inflammatory bowel disease
    100932607 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100932607 (TGFB1)
   05414 Dilated cardiomyopathy
    100932607 (TGFB1)
   05415 Diabetic cardiomyopathy
    100932607 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100932607 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100932607 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:shr03110]
    100932607 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100932607 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100932607 (TGFB1)
Chaperones and folding catalysts [BR:shr03110]
 Intramolecular chaperones
  Others
   100932607 (TGFB1)
Cytokines and growth factors [BR:shr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100932607 (TGFB1)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100932607 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100932607
NCBI-ProteinID: XP_031819770
LinkDB
Position
3
AA seq 383 aa
MPPSGLRAAAAAAALVPLLALLLAPPRPAAAMSTCKTLDMELVKRRRIEAIRGQILSKLR
LDSPPSPGDVPPGPXPDAVLALYNSTRDRVAEPGPEAETDYYAKEVTRVLMLPQSPDVEK
IPHSVYFHFNTSELQEAVPNPALLSRAELRMLKTKSTVEQHVELYQKFGNGSWRYLTNQR
VRPSQGVEWLSFDVTSVVYQWLSSREKTETFRLSAHCSCDQKDTQLHMDISGLNNVRGDM
GIIQNQNRPFLLLMATPLDRAQNLHTHRNRRALDTDYCFSSSEKNCCVRQLYIDFRKDLG
WKWIHEPKGYHANFCLGPCPYIWSLDNQYSKVLALYNQHNPGASVNPCCVPQALEPLPIV
YYVGRKPKVEQLSNMIVRSCKCS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcgggcggcggcggcggcggctgccctggtgccgctgctggcg
ctcctgctggccccgccgcgcccggctgcggccatgtccacctgcaagaccttggacatg
gagctggtgaagcggcggcgcatcgaggccatccgcgggcagatcctgtccaagctgcgg
ctggacagcccgccaagcccgggcgacgtgcccccgggccctnngcccgacgccgtgctc
gccctctacaacagcacccgggaccgcgtggccgagccggggcccgaggccgagaccgac
tactacgccaaggaggtcacccgggtcctcatgctgccccagagccctgatgttgagaag
atcccccatagcgtctacttccacttcaacacctcggagctccaggaagccgtgcccaac
ccggccctgctgtctcgagccgagctccggatgctaaagaccaagtctacggtggaacag
cacgtggagctctatcagaaatttggcaacggctcctggcgctacctgaccaaccagcgc
gtgcggcccagccagggcgtggagtggctgtcctttgatgtcaccagtgtggtgtaccag
tggctgagtagcagagaaaagaccgagaccttccgcctcagcgcccactgctcgtgtgac
cagaaggacacccagctacatatggacattagtggtctgaacaatgtccgcggagacatg
ggcatcattcagaaccagaaccgtcctttcctgctgctcatggccaccccgttggacagg
gcccagaaccttcacacccacaggaaccggagggccctggacaccgactactgcttcagc
tcctcggagaagaactgctgtgtccggcagctctacatcgattttcgcaaagatttgggc
tggaagtggatccatgagcccaaaggttatcatgccaatttctgcctggggccctgtccc
tacatctggagcctggacaaccagtacagcaaggtcctggccctctacaaccagcacaac
ccgggggcctcggtcaacccttgctgcgtgccccaggccctggagcccttgcctatcgtt
tactatgtggggcggaagcccaaggtggagcagctgtccaacatgattgtccgctcctgc
aagtgcagctga

DBGET integrated database retrieval system