KEGG   Sarcophilus harrisii (Tasmanian devil): 100914956
Entry
100914956         CDS       T02286                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04110  Cell cycle
shr04144  Endocytosis
shr04218  Cellular senescence
shr04350  TGF-beta signaling pathway
shr04371  Apelin signaling pathway
shr04390  Hippo signaling pathway
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04659  Th17 cell differentiation
shr04926  Relaxin signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05142  Chagas disease
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05321  Inflammatory bowel disease
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100914956 (SMAD2)
   04390 Hippo signaling pathway
    100914956 (SMAD2)
   04371 Apelin signaling pathway
    100914956 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100914956 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100914956 (SMAD2)
   04218 Cellular senescence
    100914956 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100914956 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100914956 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100914956 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100914956 (SMAD2)
   05205 Proteoglycans in cancer
    100914956 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100914956 (SMAD2)
   05212 Pancreatic cancer
    100914956 (SMAD2)
   05225 Hepatocellular carcinoma
    100914956 (SMAD2)
   05226 Gastric cancer
    100914956 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100914956 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100914956 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100914956 (SMAD2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100914956 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100914956 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100914956
NCBI-ProteinID: XP_031801833
Ensembl: ENSSHAG00000012837
LinkDB
Position
1
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSASGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPSTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcatctatcttaccattcactccaccagttgtgaagaggctgttgggatggaagaaa
tctgccagtggttctggaggagcaggtggtggagaacagaatggacaggaagaaaaatgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaactggaagattagatgaa
cttgaaaaagctatcactactcaaaactgtaatacgaaatgtgtaacaataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccagatcccttgatggtcgtctacaggtatctcatcga
aaaggattaccacatgtcatttattgccgcttgtggcgctggccagatcttcacagtcac
catgaacttaaagcaattgaaaactgtgaatatgcttttaatcttaaaaaggatgaagtt
tgtgtaaacccataccattaccagagagtggagactccagttttgcctcctgtattagtg
ccacggcatactgagattcttacagaactaccccccttggatgattatactcattccatt
ccagaaaacactaatttcccagccggaattgagccccagagtaattacataccagaaaca
ccaccccctggatatatcagtgaagatggagaaacaagtgatcaacagttaaaccaaagt
atggacacaggatctccagcagaactttctcctagtactctttccccagttaatcatagc
ttggatttgcagccagttacttattcagaacctgcattttggtgttcaatagcatattat
gagctaaatcaaagggttggagaaacctttcatgcatcacagccttcactgactgtagac
ggatttacagatccatcaaattcagagagattttgcttaggtttactttccaatgttaac
cgaaatgctacagtggaaatgacaagacggcatataggaagaggagtacgcttgtattat
attggtggagaagtttttgctgagtgcctaagtgatagtgcaatctttgtccagagtcca
aattgtaatcagagatatggctggcatcccgcaacagtgtgtaaaattccaccaggctgt
aatctaaagatcttcaataaccaggagtttgctgctcttttggctcaatctgtgaatcag
ggttttgaagccgtgtaccagttaactagaatgtgcaccataagaatgagttttgttaaa
ggttggggagcagaatacagaaggcagacagtaacaagcaccccttgctggattgaactt
catctgaatggacccctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100923201
Entry
100923201         CDS       T02286                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04144  Endocytosis
shr04218  Cellular senescence
shr04310  Wnt signaling pathway
shr04350  TGF-beta signaling pathway
shr04371  Apelin signaling pathway
shr04390  Hippo signaling pathway
shr04520  Adherens junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04659  Th17 cell differentiation
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05161  Hepatitis B
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05321  Inflammatory bowel disease
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100923201 (SMAD3)
   04350 TGF-beta signaling pathway
    100923201 (SMAD3)
   04390 Hippo signaling pathway
    100923201 (SMAD3)
   04371 Apelin signaling pathway
    100923201 (SMAD3)
   04068 FoxO signaling pathway
    100923201 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100923201 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100923201 (SMAD3)
   04218 Cellular senescence
    100923201 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100923201 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100923201 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100923201 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100923201 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100923201 (SMAD3)
   05212 Pancreatic cancer
    100923201 (SMAD3)
   05225 Hepatocellular carcinoma
    100923201 (SMAD3)
   05226 Gastric cancer
    100923201 (SMAD3)
   05220 Chronic myeloid leukemia
    100923201 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100923201 (SMAD3)
   05161 Hepatitis B
    100923201 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100923201 (SMAD3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100923201 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100923201 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100923201
NCBI-ProteinID: XP_031811195
LinkDB
Position
2
AA seq 426 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNI
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEMCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNYIPET
PPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYE
LNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYI
GGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQG
FEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSI
RCSSVS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcttccatcctgcccttcacccccccgatcgtgaagcgcctcctgggctggaagaaa
ggcgagcagaacgggcaagaagagaagtggtgcgagaaggcggtcaaaagcctggtcaaa
aagctaaagaagaccgggcagctggatgagctggagaaggctatcaccacgcagaacatc
aacaccaaatgcatcaccatccccagatccttggatggccgactgcaagtgtctcaccgc
aaagggctgccccatgtcatctattgtcgcctttggcgatggcccgaccttcacagccac
catgagctccgggccatggagatgtgtgaatttgccttcaacatgaagaaggatgaagtc
tgtgtgaatccctatcattaccagagagtagagacaccagttcttcctcctgttttggtc
ccaagacacacagagatcccagccgagttccctccgttagatgactacagccattccatt
ccggagaatactaacttccctgcagggatcgaaccccaaagcaattacattccagaaacc
ccaccccctggttacctgagcgaagatggagaaaccagtgatcaccagatgaatcacagc
atggatgcaggttctccaaacttatctccaaatcctatgtcccccgcacacaataatttg
gatctgcaacctgtcacatactgcgagccagccttctggtgctccatctcctactatgaa
ctgaaccagagggtgggggagactttccatgcctctcagccttccatgactgtagatggt
ttcactgacccatccaactcggagcgcttctgtcttggtttattgtccaatgtgaacagg
aatgcagctgtggagcttactcgccggcacattgggagaggagtgcggctctattacatc
ggaggagaagtctttgcagaatgcctcagtgacagtgccatttttgtccagtcccccaac
tgtaaccagcgttacggctggcacccagcaactgtctgcaagattccaccaggatgcaac
ctgaagatattcaataaccaggaatttgcggccctgctggctcagtccgtcaaccagggc
tttgaggctgtttaccagctgactcggatgtgtaccattcgaatgagctttgttaaaggc
tggggagctgaatacaggagacagactgtgaccagcaccccctgttggattgagctacat
ctgaatggtcctctccagtggctggataaggtcctcacacagatgggctcccctagcatt
cgatgctctagtgtatcttag

DBGET integrated database retrieval system