KEGG   Sarcophilus harrisii (Tasmanian devil): 100915224
Entry
100915224         CDS       T02286                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04810  Regulation of actin cytoskeleton
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05217  Basal cell carcinoma
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100915224 (APC)
   04390 Hippo signaling pathway
    100915224 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100915224 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100915224 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100915224 (APC)
   05206 MicroRNAs in cancer
    100915224 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100915224 (APC)
   05225 Hepatocellular carcinoma
    100915224 (APC)
   05226 Gastric cancer
    100915224 (APC)
   05217 Basal cell carcinoma
    100915224 (APC)
   05213 Endometrial cancer
    100915224 (APC)
   05224 Breast cancer
    100915224 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100915224 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100915224 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100915224 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100915224 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100915224 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100915224 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100915224 (APC)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100915224 (APC)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100915224 (APC)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100915224 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u9 APC_rep APC_u15 SAMP APC_N_CC APC_u13 Arm APC_15aa Suppressor_APC Sec7_N
Other DBs
NCBI-GeneID: 100915224
NCBI-ProteinID: XP_031795257
Ensembl: ENSSHAG00000001133
LinkDB
Position
1
AA seq 2844 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSNNFPGVKLRPKMSIRSYGSREGSISSRSGECSPVPMGSFSR
RGFVNGSRESTGYLEELEKERSLLLAELEKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQLRVARIQQIEKDILRIRQLLQSQPA
EAERASQSKPDAISHEAERQNEGLGATEISMAPSNSGQGSIAQVDHETASVMSASSTYSV
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEEHRQILRENS
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNTKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKTSHRNKQRHKQNLYSEYAFDINRHEENRSDNFNTGNMTVLSPYLNTTVLPASSSRTNL
ESSRSEKDRSLDRERGIGLNTFHPATENSGNSSKRIGLQISTATAQIAKVMEEVSGIHVQ
EDQGSGSSTELHCIAEDRSTLRRASATLAHSNTYNFPKSDNSNRTCPMPYAKMEYKRSSN
DSLNSVSSSDGYGKRGQMKPSIESYSGDDESKFCSYGQYPADLAHKIHSANHMDDNDEEL
DTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQNEQRQSRGQNASFSAYSES
TDEKHIKFQSRFGQQECVSPYRSRGANGSEQNRVNSNHGLNQKVNQSLCHEDDYDEDKPT
NYSERYSEEEQHEEEERPTNYSIKYNEEEHHVDQPIDYSLKYTADITPSSQKPSFSFSKS
SSVQSNKTDHISSSGGNTSTASASTKRQNHLHPSSAQNRSGQTQKTASCKATSINQETIQ
TYCVEDTPICFSRCSSLSSLSSAEDEIGRDQTTRGTETSNNLQIAELKENSGSVSTDDTI
SEVPSTSQHIRTKANRLQTTSLSPSDSARHKAVEFSSGAKSPAKSGAQTPKSPPEHYVQE
TPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTP
PPVQAVQTKREVTKSKVSNTEKRESGPRQAAVNAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDHGNETEPEQLEDVSENKEKKAEKPIESE
KDILDDSDDDDIEILEECIISAMPTKSSRKAKKPSQAASKIPPPVARKPSQLPVYKLLPS
QNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAVIESTGTAGA
QLEFEKRDTIPTEGRSTDDIQTGKIPNITTSALDDNKTEEGEILAECINSAMPKGKSHKP
FRVKKIMDQIQQASTSSSGNSKSPLDNEKKKPTSPVKPMPQSVEYRTRIRKNAESKNLNI
ERSYSDNKDSKKLNLKNNPRDFIDKLPNNEERVRGSFTFDSPHHYTPIEGTPYCFSRNDS
LSSLDFDDDDVDLSREKAELKGKEAKETETKVNNHIELTSNQQPSNRTQICTKQPIDRNQ
SKPLLQKQSTFPQPSKDLPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQENNNN
KESEPTKQTEPPDSQVETSRPQTSGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQE
CISSAMPKKKRPSRFKGDDEKPSARNMDGILVEDLTLDLRDIQRPDSEHGFSPDSENFDW
KAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTS
NKGPRILKPGEKSTLETKKIESENKGIKGGKKVYKSLITGKVRSNSEVSSQLKQPLQTNM
PSISRGRTMIHIPGIRNSSSSTSPVSKKGPSLKTPASKSPSEGPASSTSPRGGKPAVKSE
LSPLTRQTSQPGGSSKGPSRSGSRDSTPSRPSQQPLSRPMQSPGRNSISPGRNGISPPNK
LSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLNKQTGLSKNTSNIPRSESASKGL
NQITSSNGTNKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKETPSPTLRRKLEESAS
FESLSSSSRPESPTRSQVQTPVLSPSLPDMSSSTHSSIQTGGWRKLPPNLNPAIEFNDGR
STKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESS
EKAKSEDEKHVSSFLGTKQTKENQGPAKGTWRKIKENEMAPTSSVSQVTSSGATNGADSK
TLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTVSEKVNSSNKDPKDNQ
GKPNGGNGSSSAPARTVGLENRLNSFIQIDSPDKKATETKSGQGNIVPTPETSETSITER
TPFSSTNSSKHSSPSGTVAARVTPFNYNPSPRKSSADSSSARPSQIPTPVNNSTKKRDSK
TENTESSGAQSPKRHSGSYLVTSV
NT seq 8535 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatacgatcagttgttaaaacaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatctaacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacagttacaaggaagtattgaagatgaagcaatg
gcatcgtctggacaaattgatttgttggaacgtctaaaagaactcaacttagacagtaat
aattttcctggagtgaaacttcgaccaaaaatgtctattcgatcctatggaagcagagaa
ggatctatatcaagtcgttcaggagaatgcagtcctgtaccaatgggttcattttcaaga
agaggctttgtgaatggaagcagagaaagcactggatatttagaagaacttgaaaaagaa
agatcactactacttgcagaacttgaaaaagaagaaaaagaaaaagattggtattatgct
caacttcaaaacctaactaaaaggatagatagtcttcctttaacagaaaatttctctttg
caaacagatatgactaggaggcagttggagtatgaagcaaggcagatcagagctgcaatg
gaagaacagctaggtacttgccaggatatggaaaaacgagcacagctaagagtggctaga
attcagcaaatcgagaaagatatacttcgcatacgacagttattacagtcccaacctgca
gaagcagagagggcatctcagagcaaacctgatgccatctcccatgaagcagagaggcag
aatgaaggcctaggagcaacagaaatcagcatggcaccatctaatagtggtcagggttct
attgcacaagtggatcatgaaacagccagtgttatgagtgctagtagtacttattctgtt
cctcgaaggctgacaagtcatctgggtaccaaggtggaaatggtttattcattgttgtca
atgcttggtactcatgataaggatgacatgtcacgaactttgctagctatgtctagctcc
caagacagctgcatatcaatgcgacaatctggatgtcttcctctccttatccagctttta
catggcaatgataaagactctgtattgttgggaaattccagaggaagtaaggaagctcgt
gctagagccagtgcagcacttcacaacatcattcattcacaacctgatgacaagcgaggc
aggcgtgaaatccgtgtccttcatcttttggaacagatccgagcttattgtgaaacttgt
tgggaatggcaagaagcccatgagcaaggcatggatcaggacaagaatcctatgccagct
cctgttgaacatcaaatctgtccagctgtgtgcgttctgatgaaactttcatttgatgaa
gaacacaggcatgcaatgaatgaacttgggggactacaggccattgcagaattattacaa
gtagactgtgaaatgtatgggcttaccaatgaccactacagtgttactttaagacgatac
gctggaatggctctgacaaacttgacttttggagatgtagcaaacaaggctactctgtgc
tctatgaaaggatgtatgcgagctcttgttgcccaattgaaatctgaaagtgaagacttg
cagcaggtcattgcaagtgttttaaggaatttgtcttggcgagctgatgtgaatagtaaa
aagactctgcgtgaagttggaagtgtaaaagctctaatggaatgtgctttggaagttaaa
aaggaatccaccctcaaaagcgtactgagtgccttatggaatttatcagcacattgcact
gaaaataaagctgatatctgtgctgttgatggtgctcttgcatttttggttggcacacta
acttaccggagccaaacaaatactttagccatcattgagagtggaggtgggatattgcgg
aatgtgtctagcttgatagccacaaatgaggaacacaggcaaatattgagagaaaatagt
tgcttacaaaccttgttgcagcacttaaagtctcatagtttgacaatagtaagcaatgct
tgtggaactttgtggaatctctcagcaagaaacactaaagaccaagaagcattatgggac
atgggggcagttagtatgcttaagaatctaattcactcaaagcacaaaatgattgctatg
ggcagtgcagcagcattgaggaaccttatggcaaacagacctgcaaaatataaggatgcc
aatattatgtctcctggttcaagcttgccatctcttcatgtcagaaagcaaaaagcacta
gaagcagaattagatgctcaacatttatctgagacttttgataatattgacaatttaagt
cccaagacgtctcatcgcaataaacagaggcataaacaaaatttatatagtgaatatgct
tttgatattaatcgtcatgaggagaataggtcagacaattttaatactggaaatatgacg
gtactttcaccatatttgaatactacagtcttgccagcatcttcatcaagaacaaatttg
gaaagctctcgatctgaaaaagaccggagcttggacagagaacgaggaattggactaaac
acctttcatccagcaacagaaaattctggaaattcttcaaagagaattggattgcagatc
tctactgctacagcccagattgctaaagtcatggaagaagtatcaggaattcatgtacaa
gaagatcaaggttcaggatcgtcaacagaattacattgtatagcagaagacaggagcaca
ttgagaagagcatctgctacccttgcacattcaaacacttataactttcccaaatcagat
aattcaaatagaacatgtcctatgccttatgccaaaatggaatacaagagatcttcaaat
gatagtttaaatagtgttagtagcagtgatggctatggtaaaagaggtcaaatgaaaccc
tctattgaatcctattctggggatgatgaaagtaaattttgtagttatggacagtatcct
gctgatttggctcataaaattcatagtgcaaatcatatggatgataatgatgaagaatta
gataccccaataaattatagccttaaatattcagatgaacagttaaattctggaagacag
agtccttcacagaatgaaagatgggcaagaccaaaacatataatagaagatgaaatcaaa
caaaatgagcagagacagtcaaggggtcaaaatgcatccttttctgcttatagtgaaagt
actgatgagaaacatatcaagtttcagtcccgttttggacagcaagaatgtgtgtctcca
tatagatcaaggggagccaatggatcagaacaaaatcgagttaattcaaatcatggactt
aatcagaaagttaaccagtctttgtgtcatgaagatgattatgatgaagataaaccaacc
aactacagtgaacgttattctgaagaggaacagcatgaggaagaagagagaccaacaaat
tatagcataaaatataatgaagaagaacatcatgtagatcaacctattgattatagttta
aaatatacagcagatattactccctcctcacagaagccatctttttcattttcaaaaagt
tcatctgtacaaagtaataaaacagatcacatctcttcaagtggtgggaatacatcaact
gcttcagctagtaccaaaaggcagaatcaccttcatccaagttcagcacagaatagaagt
ggtcagactcagaagactgcctcttgtaaagctacttctattaatcaggaaacaatacag
acttactgtgtggaagatacaccaatatgtttttcaagatgtagttcattatcttctttg
tcatctgctgaagatgaaataggacgggatcagacaacccgtgggacagagacttctaat
aatctacagatagccgaactgaaagaaaacagtggaagtgtgtcaactgatgatacaatt
agtgaagttccatcaacatcacaacatattcgaaccaaagccaacagactccaaactact
agtttatctccttcagattcagccagacataaagctgttgagttttcttcaggtgccaag
tctccagcaaaaagtggcgctcagacacctaaaagtcccccagagcattatgttcaagag
actccacttatgtttagcagatgtacttcagtcagttcactagatagttttgagagtcgt
tcaattgcaagttctgttcaaagtgaaccctgcagtggaatggtaagtggcatcataagc
cctagtgaccttccagacagtcctggacaaactatgccaccaagtagaagtaaaacccca
cctcctgttcaagctgtacaaactaagagagaggtaacaaaaagtaaagtatctaacact
gaaaagagagaaagtgggcctaggcaagctgctgtaaatgctgcagttcagagagtccag
gtgctacctgatgctgacaccttgttacattttgctacagaaagtactcctgatggattt
tcttgttcatctagtttaagtgctttgagccttgatgaaccttttatacagaaagatgtg
gaattaagaataatgccccctgtgcaggaaaatgaccatggaaacgaaaccgagccagag
cagctagaagatgtaagtgaaaataaggagaaaaaggcagagaaacctattgaatctgag
aaagatatactggatgactctgatgatgatgatattgaaatattagaagaatgtattatt
tctgctatgccaacaaaatcttcacgtaaagccaaaaagccctcacaagctgcttcaaaa
atacctcctccagtggcaaggaaaccaagtcagctgcctgtgtacaaacttcttccgtca
cagaacagattgcaagctcaaaaacatgttagttttactcctggagatgatatgccacga
gtatattgtgtagaaggcacacctataaacttttccacagctacatctctaagtgatctc
acaatagaatcacctccaaatgaattggccgttattgagagtactggcacagcaggagca
caattagagtttgaaaaaagagatactattcctacagaaggcagaagtacagatgacatt
caaacaggaaaaattccaaatataactacctctgcattagatgacaataaaacagaagaa
ggtgaaatccttgctgagtgtattaattcagctatgcctaaaggaaagagtcataagcct
ttccgtgtgaagaagataatggatcagattcaacaagcatcaacatcttcatctggaaat
agtaaaagcccactagacaatgagaaaaagaaacctacatcaccagtaaagccaatgcca
caaagtgttgaatatcgaactcgtataagaaaaaatgcagaatcaaaaaatttgaatatt
gaaagatcttactcagataacaaggactcaaagaaactgaatttgaaaaacaatccaaga
gactttattgataagcttccaaataatgaagagcgtgtgagaggaagctttacttttgat
tctccacatcactatacacctattgagggaactccttactgtttctcacgaaatgattct
ttgagttctcttgacttcgatgatgatgatgttgacctttccagggaaaaggcagagttg
aaaggaaaagaagctaaggaaacagaaactaaagttaataaccatatagaactaacatca
aaccaacagcccagtaatagaacacagatttgtacaaaacaaccaatagatagaaatcag
tctaaacccttgctgcagaagcagtccacttttcctcaaccatccaaagatttgccagac
agaggagcagccacagatgaaaagttacagaattttgcaattgaaaataccccagtttgt
ttttctcgaaactcatctctgagttctctcagtgacattgaccaggaaaataacaataac
aaagaaagtgaacctactaaacagactgagccacctgattcacaggtagaaacaagtaga
cctcagacatcaggttatgctcctaaatcattccatgttgaagataccccagtgtgtttt
tcaagaaatagttcacttagttctcttagcatagattctgaagatgaccttttacaggaa
tgtatcagttctgcaatgccaaaaaagaaaaggccatcaaggttcaaaggtgatgatgaa
aaacctagtgctaggaacatggatggtatattagtagaagatttgacattagatttaaga
gacatacagagacctgattcagaacatggtttttctcctgattcagaaaactttgattgg
aaagctattcaagaaggtgcaaattctatagttagtagtttacatcaggctgctgctgct
gcttgtttatctagacaagcttcatctgattctgattccattctttcactaaagtcaggt
atttctcttggatcaccatttcatcttacacctgatcaagaggaaaaaccctttacgagt
aacaaaggcccacgaattctaaagccaggtgagaaaagtacattggaaactaaaaaaata
gagtctgaaaataaaggaatcaaaggaggaaagaaagtttataaaagtttgatcactgga
aaagttcgttctaattcagaagtttcaagccagttgaaacaacccctgcaaacaaacatg
ccttcaatttctcgaggaaggacaatgattcacattccaggaatccgaaatagctcttca
agtacaagtccagtttcgaaaaagggaccatccctcaaaaccccagcttccaaaagtccc
agtgagggcccagcatctagtacttctcctagaggaggtaaaccagcagtgaaatcagaa
ttaagtcctttgaccaggcagacatcccaaccaggtggttcaagtaaaggaccttctaga
tcaggatctagagattcaactccttcaagaccatcccagcaaccattgagtagacctatg
cagtctccaggaagaaactcaatttctcctggtagaaatggaataagtcctcctaacaaa
ttatctcaattgccccgaacatcatcccccagtactgcatcaactaagtcctcaggttca
gggaaaatgtcatatacatctccaggaagacagatgagccagcaaaaccttaataaacaa
acaggtttatccaagaataccagtaatatacccagaagtgaatctgcctccaaaggacta
aatcagataactagcagcaatggaacaaataaaaaagttgaactttctagaatgtcttcg
accaaatctagtggaagtgaatctgacagatcagaaagacctgttttggtacgtcagtca
actttcatcaaagaaactccaagcccaacactgagaagaaaattggaagagtctgcatca
tttgaatctttgtcttcatcttctagaccagagtctcctactagatcccaggtacaaact
ccagttttaagtccatcccttcctgatatgtcttcatctacacattcatccattcagact
ggtggttggcggaaactcccacctaatcttaatcctgctatagaatttaatgatggaaga
tcaacaaagcgccatgatatagctcgctcccattctgagagcccttctagacttccaatt
aataggtcaggaacttggaaacgtgaacacagtaagcattcatcatcacttcctcgtgta
agcacttggagaagaactggaagttcctcttcaattctctctgcttcatcagaatccagt
gaaaaggcaaaaagtgaagatgaaaaacatgtgagctcatttctaggaacaaaacagact
aaagaaaaccaagggccagcaaaaggaacttggagaaaaataaaagaaaatgaaatggct
cctacaagtagtgtttcccaggttacttcctcaggtgctacaaatggtgcagattcaaag
actttaatttatcaaatggcacctgctgtctccaagacagaagacgtgtgggtaagaatt
gaggattgtcccattaataaccctagatcaggaagatctcctactggaaacaccccccca
gtgattgacactgtttcagagaaagttaattctagtaataaagatccaaaagataatcag
ggaaaaccaaatgggggtaatggcagtagtagtgctcctgctcgcactgtaggcttagaa
aaccgtctgaattctttcattcagatagatagcccagacaaaaaggctactgagacaaaa
tcaggacaaggaaatattgtccccacaccagagactagtgaaacttctattactgagcgt
acaccattcagttctaccaactcaagcaagcacagttcacctagtggaactgttgctgct
agggtaacacctttcaattacaatccaagtcctaggaaaagcagtgcagatagcagttca
gcccgcccatcacagatccctacaccagtaaataacagcacaaaaaagcgagattcaaaa
actgaaaacacagaatctagtggagctcaaagccctaaacgccattctgggtcttacctg
gtaacttctgtttaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100925931
Entry
100925931         CDS       T02286                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04310  Wnt signaling pathway
shr04390  Hippo signaling pathway
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04810  Regulation of actin cytoskeleton
shr04934  Cushing syndrome
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05217  Basal cell carcinoma
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100925931 (APC2)
   04390 Hippo signaling pathway
    100925931 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100925931 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100925931 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100925931 (APC2)
   05206 MicroRNAs in cancer
    100925931 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100925931 (APC2)
   05225 Hepatocellular carcinoma
    100925931 (APC2)
   05226 Gastric cancer
    100925931 (APC2)
   05217 Basal cell carcinoma
    100925931 (APC2)
   05213 Endometrial cancer
    100925931 (APC2)
   05224 Breast cancer
    100925931 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100925931 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100925931 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    100925931 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100925931 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100925931 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100925931 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100925931 (APC2)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100925931 (APC2)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100925931 (APC2)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100925931 (APC2)
SSDB
Motif
Pfam: APC_basic Arm_APC_u3 APC_rep APC_r APC_N_CC SAMP Arm Suppressor_APC DUF695 HTH_19 IL4 HALZ
Other DBs
NCBI-GeneID: 100925931
NCBI-ProteinID: XP_031803919
Ensembl: ENSSHAG00000013109
LinkDB
Position
1
AA seq 2451 aa
MGLLWFLSFLHSTFFGDEVLEELKMSGPGPTASYEQLVRQVEALSRENTHLRRELQDNSS
HLSKLENETSDMKEVLKHLQGKLEQEARAMVSSGRTELLEQLKALQMDITNLYNLKFQPP
ALAAEPGSRSRSRSPEGSPLHCAAPAATAQGLPKKREELGELSRATVRLLEELDKERCFL
LAEIEKEEQEKLWYYGQLQSLSQRLDELPQSETFSMQTDLIRQQLEFEAQHIRALMEERF
GTSDEMVQRAQIRASRLEQIEKELAEAQAQTQTRERAQQPQPEHQTLLGIKPTGAEGDGE
PEAPTHPEDGTSQLSNSKVEVVFWLLSMLATRDKEDMARTLLAMSSSQESCVAMRRSGCL
PLLLQILHDADREAGPAEGAKDARMRANAALHNIIFSQPDEGQAKKEMRVLHVLEQIRSY
CETCWDWLRMQGQDGGQGPEGGAGPVPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQA
VAELLQVDYEMHKMTNDPLNLALRRYAGMALTNLTFGDVVNKATLCARRGCMQAIVAQLA
SDSEELHQVVSSILRNLSWRADINSKKVLREVGSMTGLMQCALRATKESTLKSVLSALWN
LSAHSTENKAAICLVDGALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATREDYRQ
VLRDHNCLQTLLQHLRSHSLTIVSNACGTLWNLSARSPRDQELLWDLGAVSMLRNLIHSK
HKMIAMGSAAALRNLLTHRPLKYKDTAAVISPGSCMPSLYVRKQKALEAELDARHLAEAL
DTMEKQSLKGQVAKKPPLRHLDSLVKDYASDSGCFDDEDVPALAPGVEVGNPSVLSMFLN
SSFLQGQALPRMPPPRRGPEAEKEDGSSGRGSMDAKKGVMDGTAAAAEKLATKLSVAVAK
IDKLVEDISALHTSSEDSFSLSSGDHGLDWPSGPGEVREARAQSCSPCRLPEAGRREGVG
RAHPLLRLKAAYTSLSNDSLNSSSTSDGYCPREHMKPSPRASFADYREELQRYQQRPSRL
DLKNVVATQPERREPPAQEPAALQGPEMPDGLHKPAVFPGEWAPKDGEGKLAPDAQVHTI
KLSPSYQHVPLLEGMAKVGAVPFPGTGGSSMARKQAWLPPGTLKGSEGLSKIPEKLVAPA
PPAPAAETLQKYSVEDTPICFSRCSSLSSLSSADHGMDGRSRSEDNDLDSDSSLEILEEP
GPGEGEDDGVEDWRPRGAASLPVAIPAPRGDRGDEGASPSQQEDMTPSSSSENYIQETPL
VMSRCSSVSSLGSFESPSIASSIQSDPCSEMVSGTVSPSELPDSPGQTMPPSRSKTPLPE
RETSQFNLQWENNVKKFMDITDFKERFQLPPDLDSTIYFTVEKPDENFSCASSLSALPLH
EHYVQKDVELKLLPPFPERGGGLHFAGHEKREEPGREERLDGPRGGRPRIETHSEDDLEI
LKECISSAMPSRFRKVKTALVPGLPAGKKGLHVPVYMLVPAHAHPSLAARTPRPSRSPYK
EEDSFTDSAEGTPVNFSSATSLSDETLQYPSKDSQGQRAERREPVSRRVTSSHSTPTKMA
GTYKHRVGGASLPLSNRNAEPSRGSLKNLPSLELTVSRPRSAHSERDSRARGDSSHPSGG
HGDVAFQSFCHTTPTEEAVYCFYENDSDEASEALARKAPTGGRAPKKDHRAGKKETEPKP
KAGPPASMRPRVPTKSQHKLIADETPPCYSLSSSVSSLSDLDLSDRDGGQPPNKGGPLHL
QARKPIHTKPPPPAPGRDSSPSSPSLNSDEDLLQRCIGSAMPKRQRHAARHRKAERKPKQ
GSPKAAGSRERKAEIRRELGEEAASDRASDLDSVEWQAIQDGANSIVTWLHQAAAAATSL
SREPSSECDSILSFVSGLSVGSTLQLTLGREEQKRRGKEAGGEVEKKEQIKTAGESKKGG
EARTLNRRISRGPEKPANAQKPVSNLPAVFRGRTVIYMPTLAKGTPKPRSPPKKAVPKTE
PPAKPLPLNQQRSRSLHRPGKISEMAELTLPKRSATPPARMAKTPSSGSSQTSTPSQPSS
KKSPPSSQTSRPVPPPGGKVGTSSPQAKPVKALLSRQHKTQKSPVRIPFMQKPARKPFPG
KNTPPVPEEQGAGAKAGARLNLVRVPSTRSSGSESDRSGFLRQLTFIKESSNLLLRHRSE
ATAPLSQNSSPRRSRPSVPAVFLCSSRCEELKAAKAGPPPSPRASPGERLPRRTSSESPS
RLPVKKAAPAPEPFKRYSSSPHINVVKRSASPAPTLQQGAETGAGRRRSDGEAQPPPQVG
PGEGRAAPSAATKGTWRRIRDEDIPQILKSTLPPTALPLVGTVQEDGPAPQRKTSDAVVQ
TEDFSTSKTNSSTSPTLENREPPKNAASGPAGGAQAPFIGSDVDGLSSKVAAALAFAHEG
LTAPAGGFPSSRHSSPSRAARVTPFNYIPSPMVVPAASDKAVEKAVSLQGE
NT seq 7356 nt   +upstreamnt  +downstreamnt
atggggctgctgtggtttctgtccttcctccattccaccttcttcggggacgaggtactg
gaggaactaaagatgtcgggtccaggcccaacggcttcctatgagcagctggtgaggcag
gtggaggccttgagccgggagaacactcacctgcggagagaactccaggataactccagt
catttgtcaaagctggagaatgagacctctgacatgaaggaggtgctgaagcaccttcag
gggaagttggagcaagaagctcgagcaatggtgtcgtctgggcggactgagttgttggag
caactgaaagccctgcagatggatatcaccaacctgtacaacctcaagtttcagccaccg
gctcttgctgcagaacctggcagccggagtcggagccggagcccggagggcagccccctg
cactgtgctgcccctgcagccacagcccaagggctgcccaagaaaagagaagaattggga
gaattgagcagggccaccgtccgcctgctggaggagctagacaaagaaaggtgtttcctg
ctggctgagattgagaaggaggaacaagagaaactctggtattatgggcagctccaaagc
ttgtcccagaggctggatgagctgcctcagtcagaaacgttttccatgcagacagacctg
atccggcagcagttggagtttgaagctcagcacatccgagcgctgatggaagagcgattc
gggacctcggacgagatggtgcagagagctcagatccgagcctctcgcctggaacagatt
gagaaggagcttgcggaagcccaggctcaaacccagacccgggagcgggcgcagcagcca
cagccagaacaccagaccctcctagggataaagccaacgggagcagagggggatggggag
ccagaagcccccacccacccagaagatgggaccagccaactcagcaacagcaaggtggag
gtggtgttctggttgctgtccatgctggccacgagggacaaggaagacatggcccgcacc
ctgctggccatgtcgagctcccaggagagctgcgtggccatgcgccgctcgggctgcctg
ccgctcctgctgcagatcctccatgacgctgaccgagaggccggccccgccgagggggcc
aaggatgcccggatgcgggccaatgcggccctccacaacatcatcttctcccagcccgac
gagggccaggccaagaaggagatgcgcgtgctgcatgtgctggagcagatccgctcctac
tgtgagacttgctgggactggcttcggatgcagggccaagatggaggccagggccccgag
ggcggtgctgggcccgtacctattgaaccacagatttgccaggccacatgtgcagtaatg
aaactctcttttgatgaggaataccgccgagccatgaatgaacttggcgggctgcaggct
gtagcagagttgctgcaggtggattatgagatgcataagatgaccaatgaccctctgaat
ctggccttacggcgctacgcgggcatggccctcaccaatctcaccttcggtgacgtcgtt
aacaaggccacactgtgtgcccggcggggctgtatgcaggccattgtggcccagttggct
tcagacagtgaagagctccaccaggtggtgtccagcatccttcgaaacttgtcctggagg
gcagatatcaacagcaagaaggtcttacgggaagtgggcagtatgactgggctcatgcag
tgtgcccttcgagccactaaggagtccacactgaagagcgtcctcagtgccctgtggaac
ttgtcagctcacagcacggagaacaaggccgccatatgcttggtggatggagccctgggc
ttcctggtcagcactctcacctacaagtgccagagtaactccctagccatcatcgagagt
ggagggggcatcctccggaatgtgtccagcctcattgccacccgggaggactacaggcag
gtgctgcgggaccacaattgccttcagactctgctccagcacctgaggtcacacagcctg
accatcgtgagtaacgcctgtgggaccctgtggaacctgtcggctcggagtccccgtgac
caggagctgctctgggacctgggagccgtgagcatgctgcggaacctgatccactccaag
cacaagatgattgcgatgggcagcgcggccgccctgcgcaacctgctcacacacaggccc
ctcaagtacaaggacacggcggccgtcatctccccaggctcctgcatgcccagtctctac
gtacgcaagcagaaggcgctggaggccgagctggatgccaggcacctggccgaggctctg
gacacgatggagaagcagagcctgaagggtcaggtggccaagaagccgccgctgcgccac
ctcgacagcctggtcaaggattacgcctcggactccggctgcttcgacgatgaggacgtg
cctgccctggcgcccggggtggaggtgggcaatccctctgtcctctccatgttcctcaac
agttccttcctgcagggccaagccttgccccgcatgccgcccccccgccgcggccccgag
gcagagaaggaggatggcagcagcggcaggggcagcatggatgccaagaagggggtgatg
gacgggacggcggcggcggctgagaaactggctaccaaactgtccgtggcggtggccaag
attgacaagctggtggaggacatctcggccctgcacacctcctccgaggacagctttagc
ctcagctctggggaccatgggctggactggccctcggggcctggggaggtccgggaggcc
cgggcccagtcctgctcaccctgccgactgcctgaggcagggaggagggaaggggtgggg
agggcccacccgctgctccggctgaaggcggcttataccagcctgtccaatgacagcttg
aacagcagcagcaccagcgatggctactgcccccgagagcacatgaagccctccccaagg
gcctcgtttgctgactatcgagaggagcttcagaggtaccagcagcgccccagccgcctg
gacctcaagaacgttgtggccacccagccggaaaggagagagcctccggctcaggagcct
gctgccctgcaggggccagaaatgcctgacgggctacacaagccagcagtattccctggg
gagtgggccccaaaagatggggagggcaagcttgcccccgatgcccaggtgcacaccatc
aagctgtcgccctcctaccagcatgtgcctctgctagagggtatggccaaggttggggct
gttccctttcccggcactggaggtagctccatggcccggaagcaggcctggttgcccccg
ggcaccctgaagggctcagagggtctgagcaagatcccagagaaactggtggctcccgcc
ccccctgctcctgcggcagagaccctacagaagtactcggtggaggatactcccatctgc
ttctcccgttgctcctccctctcttccctctcctctgccgaccatggcatggacgggaga
agccgcagtgaagacaacgacctggacagtgactcgtccctggagatcctcgaggagccg
gggcccggggagggagaggatgacggcgtggaggactggaggccccgaggggccgcctcc
ctgcccgtggccatccccgctccccggggtgaccggggcgatgagggtgcctccccctcc
caacaagaagacatgaccccctccagctcctctgagaattacatccaggagactcccctc
gtcatgagccgctgcagctccgtcagctccctgggcagctttgagagcccctccattgcc
agctccatccagagtgacccctgcagtgagatggtgagtggcaccgtgagccccagtgag
cttcccgacagcccggggcagaccatgccccctagccgcagcaagaccccccttccagag
cgggagaccagccagttcaacctgcagtgggaaaacaacgtcaagaagttcatggacatc
accgacttcaaggagcgcttccagctgcccccggacctcgacagcaccatctacttcaca
gtggagaagcccgacgagaacttctcctgtgcctccagcctcagcgctctgcccctccat
gagcactatgtgcagaaggacgtggagctcaagctcctgccccctttccctgagcgtgga
ggtgggcttcacttcgccggccacgaaaaacgggaggagcccgggcgggaggagcggttg
gatgggccccgggggggccggccccgcatagagacccactctgaggacgacctggagatc
ctgaaggaatgtatcagctcagcgatgccctcccgcttccgaaaggtcaagacagccctg
gtgccgggcttgcctgcagggaagaagggcctacatgtgcccgtctacatgttggtgccc
gcacatgcccatcccagcttagcggccaggaccccccggccttcccgcagcccgtataaa
gaggaggattccttcacagactcggctgaaggcacgccagtcaacttctccagcgccacc
tcactcagtgacgagactctccagtatccatccaaggacagccaggggcagcgggctgag
aggagggagcccgtctctcggcgggtcacctccagccattctactccaaccaagatggca
ggtacctacaagcatagggtgggaggggcgagcctccctctctcaaacaggaatgccgaa
cctagccgaggctctctcaagaacctgcccagcctagaactgactgtcagccggcccagg
agtgcccactctgagagggacagccgtgccaggggagacagctcccatccaagtggaggg
cacggggatgttgccttccagtcattctgtcatactacacccactgaagaggcggtttac
tgcttctatgagaatgattcagatgaagcttctgaggccctggcccggaaggcacccacg
ggaggccgggctccaaagaaggaccatcgggcgggcaagaaagaaacagaacccaagccc
aaagcagggcccccagcttccatgcggccccgggtgcccaccaagtcccagcacaaactg
attgcagatgagacaccaccctgctactccttaagctcttccgtaagctcactcagtgac
ctggacctttcggatagggacggtgggcagccacccaacaaagggggcccgctccacctg
caggcccgcaagcccatccacactaagccccccccaccggctccgggtcgggacagttct
cccagctcaccgagcctcaactcggacgaagatctgctccaaaggtgcattggttccgcc
atgcccaaaagacaacgccatgcagcccggcaccgtaaggctgagcgcaagcccaagcaa
gggagccccaaggcagctggcagcagggagcgcaaggctgagatacgtagggagctgggc
gaggaggcggcctccgaccgagcctccgacctggacagtgtggagtggcaggctattcaa
gatggcgccaattccatcgtgacgtggctgcaccaggcggcagcggcagcaacctccttg
tccagggagccctcgtctgagtgtgattccatcctctcctttgtgtccgggctgtcagta
gggtccaccctgcagcttaccctgggaagggaggaacagaagcgcagagggaaggaggct
ggaggagaggtggaaaagaaagagcaaatcaagactgctggtgaaagcaagaaaggaggg
gaggcccggaccctcaaccgccggatatcccggggcccagaaaagccagccaatgcccag
aaacccgtgtccaatctgcccgctgtgttccggggccggacagtcatctacatgcccacc
ctggccaaggggacccccaagccgcgttctcccccaaagaaggctgtgcccaagaccgag
cctcctgccaaacccctccctctcaatcaacagagatcccggagcctccaccggccaggg
aaaatctcagagatggcagagctgacactgcccaagagaagtgccaccccacctgctcgg
atggccaagaccccctcctcaggctcttcccaaacctccaccccttcccagccatcatcc
aagaagtcgcccccctcttcccagacgagcaggccggtccccccacctgggggtaaagtg
ggcaccagcagccctcaggccaagccggtgaaggctctgctctccagacagcacaaaact
caaaaatctccagtacggatcccgttcatgcagaagccggccaggaagccgttcccgggg
aagaacacgcctcctgtcccggaggagcagggggcgggagcaaaggccggggccaggctc
aatctggtcagagtgccctccacccggtccagcggcagcgagtccgaccgttccggcttc
ctgaggcagctgaccttcatcaaggagtcttccaacctcctcctgcggcaccgctccgag
gccaccgcccccctgtcccagaacagctcccctcgccgcagtcggcccagtgtccccgcc
gtcttcctttgctcttctcgttgtgaggagctcaaagcggccaaagccgggcccccgccc
agccccagagcgtcaccaggggagcgcctgccccgccggaccagctcagagagcccctcc
cgcttgcccgtcaagaaagcggctcccgcccctgagcccttcaagcgctattcctcctcc
ccccacatcaacgtggtcaagaggtcggccagcccagcccctacccttcagcaaggggcc
gagactggggctgggcggaggcggagtgatggcgaggcccagccccctccccaggtaggg
ccgggggagggccgcgccgctccatcggcggccaccaagggcacatggcggaggattcgg
gatgaagacatcccccagatcctgaagagcacgctcccccccactgccctgcctctggtc
ggcacagtccaggaggacggcccggctccccagaggaagaccagcgacgctgtggttcag
accgaagacttctcaacttctaaaaccaactctagcacctctcccactctggagaaccgg
gagccccccaagaacgcggcgagcggcccggcaggcggcgcgcaggcccccttcattggc
agcgatgtggacgggctgagctccaaggtggctgccgccctcgcctttgcccacgagggg
ctgacggccccggccgggggcttcccctccagccgccacagctcccccagccgagccgcc
cgagttacccccttcaattacatccccagccccatggtggtgccagccgcgagcgacaaa
gctgtggagaaagctgtcagcctgcagggtgaatag

DBGET integrated database retrieval system