KEGG   Sarcophilus harrisii (Tasmanian devil): 100915415Help
Entry
100915415         CDS       T02286                                 

Definition
(RefSeq) actin, clone 302-like
  KO
K05692  actin beta/gamma 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04015  Rap1 signaling pathway
shr04145  Phagosome
shr04210  Apoptosis
shr04390  Hippo signaling pathway
shr04510  Focal adhesion
shr04520  Adherens junction
shr04530  Tight junction
shr04611  Platelet activation
shr04670  Leukocyte transendothelial migration
shr04714  Thermogenesis
shr04810  Regulation of actin cytoskeleton
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr05100  Bacterial invasion of epithelial cells
shr05132  Salmonella infection
shr05135  Yersinia infection
shr05164  Influenza A
shr05205  Proteoglycans in cancer
shr05225  Hepatocellular carcinoma
shr05410  Hypertrophic cardiomyopathy (HCM)
shr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
shr05414  Dilated cardiomyopathy (DCM)
shr05416  Viral myocarditis
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100915415
   04390 Hippo signaling pathway
    100915415
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100915415
  09143 Cell growth and death
   04210 Apoptosis
    100915415
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100915415
   04520 Adherens junction
    100915415
   04530 Tight junction
    100915415
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100915415
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100915415
   04670 Leukocyte transendothelial migration
    100915415
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100915415
   04919 Thyroid hormone signaling pathway
    100915415
  09159 Environmental adaptation
   04714 Thermogenesis
    100915415
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100915415
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100915415
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100915415
   05410 Hypertrophic cardiomyopathy (HCM)
    100915415
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100915415
   05414 Dilated cardiomyopathy (DCM)
    100915415
   05416 Viral myocarditis
    100915415
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100915415
   05135 Yersinia infection
    100915415
   05100 Bacterial invasion of epithelial cells
    100915415
  09172 Infectious disease: viral
   05164 Influenza A
    100915415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:shr03021]
    100915415
   03019 Messenger RNA biogenesis [BR:shr03019]
    100915415
   03036 Chromosome and associated proteins [BR:shr03036]
    100915415
   03029 Mitochondrial biogenesis [BR:shr03029]
    100915415
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100915415
   04147 Exosome [BR:shr04147]
    100915415
Transcription machinery [BR:shr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100915415
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100915415
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100915415
    NuA4 complex
     100915415
  Chromatin remodeling factors
   BAF complex
    100915415
   PBAF complex
    100915415
   SWR1 complex
    100915415
Mitochondrial biogenesis [BR:shr03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100915415
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100915415
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100915415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin BRICHOS
Motif
Other DBs
NCBI-GeneID: 100915415
NCBI-ProteinID: XP_003765229
LinkDB All DBs
Position
3
AA seq 378 aa AA seqDB search
MVSEITKIPSAILDNGSGLCKVGISGEQSPRFIQATVLGYPQNIIPKADTEPKACYVGQD
AQDKRNILTLRYPMQHGIVTSWDDMEKIWKHLYEHGLREPPEQRPVLLTEAPLNPPENRA
KMIEIFFETFQVPALYVALQGLMALYATGKNTGIVLDCGDGVTGVIPIYEDRCLLQSMSR
SDFAGRDVTNYLSRLLLERGIHLVNTGNKDVVTDIKERLCYVIPDPHERKKATTIDCSMY
NYILPDGHSMQIGEELFQVPESLFQPSKAGSSSPGIHKLVLKSVMKSSHHFQKDLLKNLI
LSGGSTLCPGLKKRLWMELESLLKGSPNVNITAPSDRLLSVWIGASVITSLSTFEQMWVS
RAAYHEIGPAVIQEKCFW
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggtctctgaaataactaagattccatccgccatcctcgacaatggatcagggctgtgt
aaagtcggcatttcaggggagcagagtccccgattcatccaagccacagtcctaggttat
ccccaaaatatcatccccaaggcagatacagagcccaaggcatgctatgttggacaagat
gcccaggataagagaaacatcctcacgttgagatatccaatgcaacatgggattgtcacc
tcctgggatgacatggaaaagatctggaagcatctgtatgaacacggtctcagagagccc
cccgagcagagaccggtgctcctgaccgaagcgcctctgaatcctcccgagaaccgagcc
aagatgatagagatcttcttcgagacgttccaagtgccagccctgtatgtggctctccaa
ggtctcatggcactgtacgccacagggaaaaacacgggcattgttttggattgtggggat
ggagtcactggggtcatccccatctatgaggaccgctgcctcctccaaagcatgtcccgg
tctgattttgcaggaagagatgtcaccaactacctgtccaggctgctcttggagagaggt
atccacctggtgaacacaggcaacaaggacgtggtcacggacatcaaagagagactgtgc
tacgtcatccccgacccacacgaacgaaagaaggcgacgaccattgactgctccatgtac
aattacatccttcccgacggtcactccatgcagattggggaggagttgttccaagtcccc
gagtccctttttcagccctccaaggcgggctcctcatctcctgggattcacaaattagtc
ctcaaaagcgtgatgaaaagcagccaccacttccagaaagaccttctgaagaatctgatc
ctgtctggaggctctaccctgtgcccagggctgaagaagaggctctggatggagctggag
tctctcctcaaaggaagccccaacgtcaacatcacagcgcccagcgaccgccttttgtcc
gtgtggatcggcgcttccgtcatcacgagtctgtccacctttgagcagatgtgggtctcc
agagcggcctaccatgagattggccctgcggtaattcaggagaaatgcttctggtga

DBGET integrated database retrieval system