KEGG   Sarcophilus harrisii (Tasmanian devil): 100915548
Entry
100915548         CDS       T02286                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01524  Platinum drug resistance
shr04014  Ras signaling pathway
shr04064  NF-kappa B signaling pathway
shr04115  p53 signaling pathway
shr04137  Mitophagy - animal
shr04140  Autophagy - animal
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04621  NOD-like receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05022  Pathways of neurodegeneration - multiple diseases
shr05145  Toxoplasmosis
shr05162  Measles
shr05166  Human T-cell leukemia virus 1 infection
shr05168  Herpes simplex virus 1 infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05212  Pancreatic cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100915548 (BCL2L1)
   04630 JAK-STAT signaling pathway
    100915548 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100915548 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100915548 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100915548 (BCL2L1)
   04137 Mitophagy - animal
    100915548 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    100915548 (BCL2L1)
   04215 Apoptosis - multiple species
    100915548 (BCL2L1)
   04115 p53 signaling pathway
    100915548 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100915548 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100915548 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    100915548 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100915548 (BCL2L1)
   05225 Hepatocellular carcinoma
    100915548 (BCL2L1)
   05220 Chronic myeloid leukemia
    100915548 (BCL2L1)
   05222 Small cell lung cancer
    100915548 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100915548 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    100915548 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    100915548 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100915548 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    100915548 (BCL2L1)
   05162 Measles
    100915548 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    100915548 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100915548 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100915548 (BCL2L1)
   01524 Platinum drug resistance
    100915548 (BCL2L1)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100915548 (BCL2L1)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100915548 (BCL2L1)
Transporters [BR:shr02000]
 Other transporters
  Pores ion channels [TC:1]
   100915548 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100915548
NCBI-ProteinID: XP_012409072
Ensembl: ENSSHAG00000013693
UniProt: G3WKX6
LinkDB
Position
2
AA seq 227 aa
MSHSNRELVVDFLSYKLSQKGYNWSQFEDENRTEASEGTEIPSTVNGSPSWHPADSRAVS
GATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVARITSWMATYLDEHLDPWIQENG
GWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtctcacagtaaccgggagctggtggttgactttctttcttacaagctttcacagaag
ggatacaattggagtcagtttgaagatgagaacaggactgaggcctcagaagggacagag
atacctagtactgtgaatggcagcccctcttggcaccctgctgacagccgtgcagtgagt
ggggccacaggacacagcagcagcctggatgcccatgagacaattcctgtagctgctgtg
aagcaagctttgagggaggcaggagatgaatttgaactccggtaccggcgggcattcagt
gatctgacatcccagctccacatcactccagggacggcttatcagagttttgagcaggta
gtgaatgaactcttccgggatggggtgaactggggccgaattgtggcattcttctccttc
ggaggggcattgtgtgtggaaagcgtggataaagagatggaagtcttggtagcacgcatc
acctcctggatggccacttacttggatgagcacctagacccatggatccaagaaaatggc
ggttgggacaccttcgtggagctttatgggaatgatgcagcagcagagagccggaagggc
caggaacgcttcaacagatggctgctgactggcatgacagtggctggtgtagtcctgctg
gggtccctgttcagccggaagtga

DBGET integrated database retrieval system