KEGG   Sarcophilus harrisii (Tasmanian devil): 100915745
Entry
100915745         CDS       T02286                                 

Definition
(RefSeq) uncharacterized protein LOC100915745
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100915745
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100915745
SSDB
Motif
Pfam: CKS Peptidase_M29
Other DBs
NCBI-GeneID: 100915745
NCBI-ProteinID: XP_003761295
LinkDB
Position
1
AA seq 164 aa
MSVRGWAKLGNLQWVPPLPERARDEWLLLVSNQRPVIGFKSRPLGGRELLAVTCSFRRCF
CFPGVFLGASAFRRRSSSGLCAAVSMAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKT
HLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKEQQK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagcgttaggggttgggcaaagcttggaaacctccagtgggttccaccccttccggag
agagcgcgcgatgagtggttgttgctcgtgtccaatcaacgcccggttattggattcaaa
tcaagacccctggggggaagggagctcctagcagttacttgtagtttccgtcgctgcttc
tgtttccccggtgtcttcctcggtgcctctgcttttcgccggcgtagctcttcgggactc
tgcgctgccgtcagcatggcccacaagcaaatctactactcggacaagtattttgatgag
cactacgagtaccggcatgttatgttacctagagaactttccaaacaagtaccaaaaacc
catctgatgtctgaagaggagtggaggagactaggtgtccagcagagtcttggatgggtt
cattatatgattcatgagccagaaccacatattctgctctttagaagacctcttccaaaa
gaacaacaaaaatga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100917592
Entry
100917592         CDS       T02286                                 

Gene name
CKS1B
Definition
(RefSeq) cyclin-dependent kinases regulatory subunit 1
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100917592 (CKS1B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100917592 (CKS1B)
SSDB
Motif
Pfam: CKS
Other DBs
NCBI-GeneID: 100917592
NCBI-ProteinID: XP_012403651
Ensembl: ENSSHAG00000004796
LinkDB
Position
4
AA seq 79 aa
MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMTESEWRNLGVQQSQGWVHYMIH
EPEPHILLFRRPLPKKPKK
NT seq 240 nt   +upstreamnt  +downstreamnt
atgtcgcataaacaaatttactattcggacaaatacgacgatgaggagttcgagtaccga
cacgtcatgttgcccaaggacatagccaaactggtccctaagacccatttgatgactgag
tctgagtggaggaaccttggtgtccagcagagtcagggatgggtccattacatgatccat
gaaccagagcctcacatcttgctgttccggcggccactgcccaagaagcctaagaagtga

DBGET integrated database retrieval system