KEGG   Sarcophilus harrisii (Tasmanian devil): 100915867
Entry
100915867         CDS       T02286                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X6
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04020  Calcium signaling pathway
shr04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100915867 (CACNA1E)
   04020 Calcium signaling pathway
    100915867 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100915867 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:shr04040]
    100915867 (CACNA1E)
Ion channels [BR:shr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100915867 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100915867
NCBI-ProteinID: XP_003767532
Ensembl: ENSSHAG00000013194
LinkDB
Position
4
AA seq 2415 aa
MVPEMHGHSPCPAYKSQELIPALATGESPELGLVAHRHILSLPEEETWRQHSPGMLPTQT
SALLEPEALEDAGALPGSPRALCFDASSVFFPMQEGEGSGWEGSSALDPSLSPFLPVSPE
VMKRRRGGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSEQSRN
RQGTPVQSSGAAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKK
LIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIV
ALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGI
PSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGVLEGFDP
PHPCGVQGCPDGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGA
TWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYR
AWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLAR
ASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYWMVLSVVALNTACVAIVHHNQPLWL
THLLYYAEFLFLGLFLLEMALKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGT
SFGISVLRALRLLRIFKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQL
FGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFI
VLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMP
SIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKEDAPP
MNPLNPLNPLSPLNPLNAHPSLYRRPKPLEGLGLEKFEEEPGNRGDFHKGEQSEDQKSPM
SRPRREQQWLSKSCHGNCDPAEQESGVGEAVVGFEERARHRQSQRRSRHRRVRTEMKEQA
STGESRSGSQERGLEEGITTEGEKRRDSKGNQEGKEVSIHEEERSKELKRTNSLMVSGGR
GLSTPTDEMRTPLVLSPPELETGKDIGLTEQEQEGTSEQALLEDVQLDVGRAISRSEPDL
SSITTNVEKGTESTSVAVTIPDVGTLVDSTVVHISNKTDGEASPLKEAEIKEDGEEIEKK
RKKEKSSNTGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAED
PVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGAL
VAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILI
VYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFH
YDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHF
VVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTIVFSLECILKIIAFGF
LNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIR
ILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLM
LLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYFYFVSFIFFCSFLM
LNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPP
LGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSE
LQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKIKKQRQQLEEQK
NAPMFQRMEPSSLPQEILSNAKALPYLQQDTLSGLSSRSGYPSMSPLSPQEIFQLACMDP
NHEEFQEQQSLVVTDPSSMRRSFSTIRDKRTNSSWLEEFSMERSSENTYKSRRRSYHSSL
RLSAHRLNADSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGAQGDWESPERQQ
SRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRGRRQLPPVPPKPRPLLSYSSLMRH
PGSISPPYDGSEVGSPLPSKALEGNDACLTESSSSPQAKQSQPSTPQRYISEPYLALHED
SHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCG
AVSDLLSDTEEDDKC
NT seq 7248 nt   +upstreamnt  +downstreamnt
atggtgccggagatgcatggacacagcccatgcccagcctacaagtcccaggagctcatc
cctgccttggccaccggggaaagccctgagcttggtctggttgcccaccgccacatcctg
tcccttcctgaggaggagacatggcgccagcacagcccagggatgttgcccacccagact
tctgctctgctcgagcccgaggccctggaggacgcaggagccttaccagggtccccacgt
gccctatgcttcgatgcctcctcggtcttcttccccatgcaagaaggtgagggctcagga
tgggagggcagcagtgccctcgatcccagtctgagcccattccttcctgtgagcccagag
gtcatgaaacggaggcgaggagggctgattgagcagagggacatcatcaaagcccacgaa
gcccacaagatgcagagcacacctcaagcccggaggaaagagtgggagatggctcgcttt
ggggaggctgtggttggcaggccgggatctggagatggagactccgagcagagcaggaac
cggcaaggaacaccagtgcagtcctcgggggcagcggcagcctacaagcaatccaaagcc
cagagggccaggactatggctttatacaaccccattccggtcaggcagaactgtttcacc
gtcaacagatccctgtttatcttcggagaagataacattgtcaggaaatatgcaaagaag
ctcatcgattggccgccatttgaatacatgattctggctactatcattgccaattgcatt
gtcttggcattggaacaacatcttccagaagatgataagactccgatgtccagaagattg
gaaaaaaccgaaccatattttattgggattttttgctttgaagctgggattaaaattgtg
gccctcgggtttatcttccacaagggctcatatctccgtaatggctggaatgtcatggac
ttcattgtggttctcagtggcatcctggccacagctgggactcactttaatacccatgtg
gacctgaggaccctccgggctgtgcgtgtactgaggccgctgaaacttgtgtcaggcatt
cccagtttgcaaatagtactcaagtcaatcatgaaggcaatggtgcctcttctacagatt
ggccttcttctgttctttgccatcctgatgttcgccatcattggcctggagttttacagt
ggaaaactgcacagggcctgctttatgaacaattcaggtgtgctggaggggtttgaccct
ccccacccatgtggggtgcagggctgcccagatggttatgagtgcaaagactggattggc
cccaatgatggaatcactcagtttgacaacattctctttgctgtgctgaccgtcttccag
tgtataaccatggaaggatggactaccgtgctgtacaataccaatgatgccttaggagcc
acctggaattggctgtacttcatccccctcatcatcatcggatccttctttgttctcaat
cttgtcctgggagtgctttccggggaatttgccaaagaaagagagagagtggagaaccgt
agagcctttatgaaactgcggagacagcaacaaatcgaacgagagttgaatgggtatcgt
gcttggatagacaaagcagaggaagtgatgctggctgaagaaaacaaaaattctggaaca
tcagctttggaagtgctccgaagggcaaccatcaaaaggagccgtactgaggccatgact
cgtgactcaagtgatgaacactgtgttgacatctcctctgtgggtactcctcttgcacgt
gccagtataaaaagtactaaagtagatggagcctcttattttcggcacaaggagcggctt
ctacgtatctccattcgtcatatggttaaatctcaagttttttattggatggttttgagc
gtggtagctctcaacactgcctgtgtggctattgtccatcacaaccagcccctgtggctc
acccacctcctctactatgcagagtttttgtttttgggactcttccttttagaaatggcc
ctgaagatgtatggcatggggccacgtctttattttcattcttccttcaattgctttgat
tttggggtcactgtgggaagtatctttgaagtggtttgggccatctttagacctggcacc
tcttttggaatcagtgtcttacgggctctccgacttctcagaatatttaaggttaccaag
tattgggcatccctacggaatttagtggtctcactgatgagttccatgaaatccatcatc
agtttacttttcttactcttcctctttattgttgtctttgctctgttgggaatgcagctc
tttggaggcaggtttaattttaatgatgggactccttcagcaaattttgacacctttcct
gcagccattatgacagtattccagatcttgacaggtgaggactggaatgaggtgatgtac
aatgggatccgttctcagggtggagttagctctggtatgtggtctgccatctacttcatt
gtgctcactctgtttggcaactacaccctactgaatgtgttcttggccatcgctgtggat
aatttggccaatgctcaggagctgacaaaggatgagcaggaggaggaggaggccttcaat
cagaagcatgccctacagaaagccaaggaagtcagcccaatgtctgcacctaacatgcct
tctatagaaagagacagaaggaggagacaccacatgtcgatgtgggagccacgcagcagc
cacctgagggagaggaggagacgtcatcacatgtctgtatgggaacagcgcaccagtcag
ctgaggagacacatgcagatgtccagccaggagggtatcaacaaggaagacgcccctccc
atgaatcccctcaaccccctcaatcccctcagccctctcaatcccctcaatgcacatcct
agtctttacaggaggcccaaacctttggagggtttgggactggagaagtttgaggaggaa
cctggaaatcgtggggactttcataagggtgaacaatcagaagaccagaagagtcccatg
tccaggcctaggagggagcagcaatggctctccaagtcatgccatggaaactgtgaccca
gcagagcaggaatcaggagttggagaggcagtggtgggctttgaggagcgggcccgtcac
aggcagagtcagcgccgtagccgccaccggcgagtccggactgagatgaaggaacaggct
tccactggtgaaagcagatctgggagtcaggagagaggcctggaagaagggataacaact
gagggggagaagagaagggactctaaggggaatcaggagggcaaggaggtttctattcac
gaagaagagagaagcaaagagttaaaaagaaccaatagccttatggtttcaggaggccgt
gggctatcaacacctactgatgaaatgaggactcccttggtcctctctcctccagagcta
gaaacaggaaaggacatcggcctaacagagcaggagcaggaggggaccagtgaacaagca
cttctagaggatgtacagctggatgtgggccgggctatcagtcgcagtgagcctgacctt
tcctccataacaaccaacgtggagaagggcacggagagcactagtgttgccgtcaccatc
cctgacgtgggcaccttggtggattccactgtggtgcatattagcaacaaaacagatgga
gaagctagccccttgaaggaggcagagattaaagaggatggagaagaaattgagaaaaag
cgaaagaaggaaaagagctcaaacacaggcaaagcaatggtgccccacagctctatgttc
atcttcagcactactaacccgattcgaagggcatgccactacattgtgaatctacgctac
tttgaaatgtgcatccttttggttattgcagccagcagcattgccttggctgctgaggat
ccagtcctgactaactcagaacggaacaaagtcctgaggtattttgactatgtttttact
ggcgtattcacctttgagatggttataaagatgatagaccagggcctgattctacaggat
ggatcttactttcgagacctgtggaatatcttggactttgtggtggtagttggggcattg
gtggcctttgctttggcgaacgctttgggaaccaacaaaggccgggatatcaaaaccatt
aagtctctgcgtgtgctccgagttctgaggccactgaaaaccatcaaacgcttacccaag
ctgaaggctgtctttgactgtgtagtgacctccctgaagaatgtattcaacatactcatt
gtctacaagctcttcatgttcatctttgccgtcattgcagttcaactcttcaagggaaaa
ttcttttattgcacagatagctccaaagacacagaaaaggaatgcataggcaactatgtg
gatcatgaaaaaaacaagatggaggtaaagggtcgggaatggaaacgtcatgagttccac
tatgacaacatcatttgggccctcttgacccttttcactgtatctacaggggagggctgg
ccgcaagttttgcagcattctgtggacgtgactgaggaagaccggggcccaagccgcagc
aatcgcatggaaatgtcaattttttatgtggtttacttcgtggtcttccccttcttcttt
gtcaatatctttgttgccctcatcatcattactttccaggagcaaggggacaagatgatg
gaagagtgtagcttggaaaaaaatgagagggcatgcattgattttgccatcagtgccaaa
ccactcacccgctacatgccccagaaccggcatacctttcagtaccgtgtttggcatttt
gtggtatccccatctttcgaatacaccatcatggccatgattgccttgaacactgtggtg
ctgatgatgaagtactactctgctccctgtacctatgaactggcactgaagtatctgaat
atagcttttaccatcgtgttctcactggaatgcatcctcaagattattgctttcggcttc
ttgaattatttccgagacacctggaacatctttgatttcattacagtcattggcagcatc
acagaaattatactgacagacagcaagctggtgaatactagtggcttcaatatgagcttt
ctaaagctctttcgagcagcccgtcttatcaagctcctccgacagggttataccatccgt
attttgctatggacttttgttcagtcttttaaggccctcccctatgtctgtctattgatt
gccatgcttttcttcatttatgccattattgggatgcaggtttttggaaatataaaatta
gatgaagagagtcacattaaccgacacaacaacttccgaagtttttttgggtccctcatg
ctgctcttcaggagtgccacaggtgaggcatggcaggaaattatgttatcttgtctggga
gagaaaggctgtgaacctgataccactgcaccctcagggcagaatgagaatgaacgatgt
ggcactgatctggcctacttttactttgtttctttcatctttttctgctcttttttgatg
cttaacctgtttgtggctgttatcatggacaattttgagtacttgacccgggactcatct
atccttggacctcatcacttagatgaatttgtccgagtctgggcagagtatgatcgagct
gcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccg
ctaggcctcggcaagagatgtccctccaaagtggcgtataagagattggttctgatgaac
atgccagtagctgaggacatgaccgtccatttcacttctacactgatggctctaattcga
acagctctggacatcaagattgcaaaaggtggtgcagataggcagcagctggattctgag
ctgcaaaaggagaccctggctatctggcctcacctgtcccagaagatgctggatctgctt
gtacccatgccaaaagcctcagacttgacagttgggaaaatatatgcagccatgatgatc
atggactattataagcaaagcaaaataaagaagcagagacagcagctggaagaacagaaa
aatgctcccatgttccagcgaatggaaccctcatctttgcctcaggagatcctttctaat
gccaaagccctgccttatctccagcaggacactctttcaggcctgagcagtcggagtggg
tacccatctatgagtccactttctccccaagaaatattccagttggcttgtatggaccca
aaccatgaggagttccaggagcaacagtctctggtggtgacggacccaagctccatgagg
cgttccttttccactatcagagacaagcgcacgaactcctcctggttagaggagttttca
atggagcgaagcagtgaaaacacctacaagtctcgccgacgcagttaccattcttctttg
cgcctgtcagctcaccggctgaatgccgactcaggccacaaatctgatacccatcgctca
ggaggcagagaacgtggccgatccaaagaacgcaagcaccttctgtctcctgatgtatcc
cgctgtaattctgaagaacggggtgctcagggagactgggagtctcctgagcgacaacag
tccagatcacctagtgagggcaggtctcagacacccaacagacaaggtacaggttccctt
agtgaaagctccattccttctatctctgacaccagcaccccaaggcgaggtcgtcgacag
cttccacctgttccccccaaaccccggcccctcctctcctacagctccttgatgcgacat
cctggtagcatctccccaccatatgatgggagtgaagttggctccccactcccctccaag
gccctggaaggcaatgatgcttgcctgactgagtcttccagctcaccacaagcaaagcag
agtcagccctccactccccagcgctatatctcagagccttacctggctttgcatgaagac
tcccatgcctcggactgtggcgaggaggaaacactcacctttgaggctgctgtggccacc
agcctgggccgctccaacaccattggttcagcccctcccctgagacacagctggcagatg
cccaatgggcactaccggaggcggaggcgtgggggaccagggccagggatgatgtgtggg
gctgttagtgatctcctgagtgacacagaagaagatgataaatgctag

DBGET integrated database retrieval system