KEGG   Sarcophilus harrisii (Tasmanian devil): 100916189
Entry
100916189         CDS       T02286                                 

Gene name
TFG
Definition
(RefSeq) protein TFG isoform X1
  KO
K09292  protein TFG
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916189 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100916189 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 100916189
NCBI-ProteinID: XP_031815457
Ensembl: ENSSHAG00000013503
LinkDB
Position
3
AA seq 396 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DCLEPPGEPGPSTSLPENDTVDSREEKPTASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEERSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQI
EGQMYQQYQQQASYGTQQPQAQPPQQYGMQYSGYSQQAGPQPPQQFQGYAQQPTSQPPAP
GFSGQPQQLPAQPPQQYQASNYPAQNYTTQASQPTSYTPASQPGMAQSQPGAYQPRPGYT
PPPGSTMTPPPSGPNPYARNRPPFTQGYTQPGPGYR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaatgggcagttggatttaagtggaaagctaattattaaagctcagcttggggaagat
attcggagaattcctatacataatgaagatattacctatgatgaattagtgctgatgatg
caaagagtttttcgtggaaaacttctgagtaatgatgaagttactataaagtataaagat
gaagatggagatcttataacaattttcgatagctctgatctttcctttgcaattcagtgt
agcaggatattgaaactaacactgtttgttaatggacaaccaaggcctcttgaatcaagt
caggtgaaatatctccgtagagaactgatagaacttagaaacaaagtgaatcgtttgttg
gattgtttagaaccacctggtgaacctggaccttccaccagtctccctgaaaatgatact
gtggatagtagggaagaaaaacccactgcttctgattcttcaggcaaacaatctacccaa
gtgatggcagcaagtatgtctgcttttgatccattaaaaaatcaagatgaaatcaacaaa
aatgtcatgtcagcctttggtcttacagatgatcaggtttcaggaccacccagtgctcct
gcagaagaacgttctggaacaccagatagcattgcttcctcctcatctgcagctcatcca
ccaggtgtccagccacaacagcctccatatacaggagctcaaacacaggcaggtcagatt
gaaggtcagatgtatcaacagtaccaacaacaggccagctatggtactcagcagccacag
gctcaacctccacaacaatatggtatgcagtattcaggctacagtcagcaggctggaccc
caacctcctcaacagttccaaggatatgctcaacaaccgacttcccagcccccagctcct
ggtttttctggacagcctcaacaactgcctgctcaacctcctcagcagtaccaggcgagc
aattatcctgcacagaattacactactcaagcttctcaacctactagttatacccctgcc
tctcaacctggaatggctcaaagtcagccaggtgcctatcaaccaagaccgggctatact
ccacctcctggaagtactatgacccctcctccaagtgggcccaacccttatgcacgtaac
cgtcctccctttactcagggttatacccagcctggacctggttatcgatag

DBGET integrated database retrieval system