KEGG   Sarcophilus harrisii (Tasmanian devil): 100916189
Entry
100916189         CDS       T02286                                 

Gene name
TFG
Definition
(RefSeq) protein TFG isoform X1
  KO
K09292  protein TFG
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916189 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100916189 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 100916189
NCBI-ProteinID: XP_031815457
Ensembl: ENSSHAG00000013503
LinkDB
Position
3
AA seq 396 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DCLEPPGEPGPSTSLPENDTVDSREEKPTASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEERSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQI
EGQMYQQYQQQASYGTQQPQAQPPQQYGMQYSGYSQQAGPQPPQQFQGYAQQPTSQPPAP
GFSGQPQQLPAQPPQQYQASNYPAQNYTTQASQPTSYTPASQPGMAQSQPGAYQPRPGYT
PPPGSTMTPPPSGPNPYARNRPPFTQGYTQPGPGYR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaatgggcagttggatttaagtggaaagctaattattaaagctcagcttggggaagat
attcggagaattcctatacataatgaagatattacctatgatgaattagtgctgatgatg
caaagagtttttcgtggaaaacttctgagtaatgatgaagttactataaagtataaagat
gaagatggagatcttataacaattttcgatagctctgatctttcctttgcaattcagtgt
agcaggatattgaaactaacactgtttgttaatggacaaccaaggcctcttgaatcaagt
caggtgaaatatctccgtagagaactgatagaacttagaaacaaagtgaatcgtttgttg
gattgtttagaaccacctggtgaacctggaccttccaccagtctccctgaaaatgatact
gtggatagtagggaagaaaaacccactgcttctgattcttcaggcaaacaatctacccaa
gtgatggcagcaagtatgtctgcttttgatccattaaaaaatcaagatgaaatcaacaaa
aatgtcatgtcagcctttggtcttacagatgatcaggtttcaggaccacccagtgctcct
gcagaagaacgttctggaacaccagatagcattgcttcctcctcatctgcagctcatcca
ccaggtgtccagccacaacagcctccatatacaggagctcaaacacaggcaggtcagatt
gaaggtcagatgtatcaacagtaccaacaacaggccagctatggtactcagcagccacag
gctcaacctccacaacaatatggtatgcagtattcaggctacagtcagcaggctggaccc
caacctcctcaacagttccaaggatatgctcaacaaccgacttcccagcccccagctcct
ggtttttctggacagcctcaacaactgcctgctcaacctcctcagcagtaccaggcgagc
aattatcctgcacagaattacactactcaagcttctcaacctactagttatacccctgcc
tctcaacctggaatggctcaaagtcagccaggtgcctatcaaccaagaccgggctatact
ccacctcctggaagtactatgacccctcctccaagtgggcccaacccttatgcacgtaac
cgtcctccctttactcagggttatacccagcctggacctggttatcgatag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100916388
Entry
100916388         CDS       T02286                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04722  Neurotrophin signaling pathway
shr04750  Inflammatory mediator regulation of TRP channels
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05216  Thyroid cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100916388 (NTRK1)
   04014 Ras signaling pathway
    100916388 (NTRK1)
   04151 PI3K-Akt signaling pathway
    100916388 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100916388 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100916388 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100916388 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916388 (NTRK1)
   05202 Transcriptional misregulation in cancer
    100916388 (NTRK1)
   05230 Central carbon metabolism in cancer
    100916388 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100916388 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100916388 (NTRK1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100916388 (NTRK1)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   100916388 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LRR_8 Ig_3 Ig_2 TrkA_TMD I-set TPKR_C2 ig C2-set_2
Other DBs
NCBI-GeneID: 100916388
NCBI-ProteinID: XP_031822658
Ensembl: ENSSHAG00000016453
LinkDB
Position
4
AA seq 795 aa
MLRAGRSGQLGRQGCPWALLAWLLLVPSGIAHCPHACCPFGPSGLLCVKPGALSSFGLLT
SLENLTSLENLTELHIENQKDLKHLALSDLSFLRELRNLTIVHSGLQSVAPDAFHFTPRL
SRLNLSSNALNSLSWKTVQGLPLQELILTGNPLNCSCALQWLQRWEDKGLAKLGFPCQEP
AAIMPNDSCGKPLLKIELSSATVNVGDNVTLNCQMESQGRSWAGWNIEELSEFATVVPLE
SGNLSSLWLILVNVSSDLNRKNVTCWAENDVGRSEESVQINVSFPAKVHLHQAIAQHHWC
IPFSVDGQPPPTITWRFNGHVLNETNFIFTEFLEQAANETMQHGCLRLNKPTHVNNGNYT
LEASNPGGRDVASRFFIFMDNPFQFKPEDPIPVSYSPGATNSTSGHPVEKKEDSYFGVSV
AVGLAVFACLFLLVLLILLNKCGRRSKFGINRPAVLAPEDSLAMSLHFMTLGNSSLSPEG
KGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLV
AVKALKEVSESARQDFQREAELLTVLQHQHIVRFFGVCTEGRPLLMVFEYMKHGDLNRFL
RSHGPDAKILASGVGTAPGPLGLGQLLAVAGQVAAGMVYLASLHFVHRDLATRNCLVGQG
LVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVLLWEIF
TYGKQPWYQLSNTEAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDIHARL
QALIKAPPVYLDVLG
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgctcagagccgggaggagcgggcagcttggcaggcagggctgcccctgggccctgcta
gcctggctgcttctggtgccctcgggcattgcccactgcccccatgcctgctgccccttt
ggcccctcagggctgctctgcgtaaagccaggagctctctccagctttggcctcctgaca
agcttggagaacctgacaagcttggagaacctgacggagctccatattgagaaccagaag
gacttgaagcatctggccctgtctgacctgagcttcctgagagagctgaggaacctcacc
attgtacacagtggtctccaatcggtggctccagatgcctttcacttcacccctcggctg
agcagattgaatctttcttccaatgcactgaactcactttcttggaaaactgttcagggc
cttcccctgcaggaactgattctgactggaaaccccctgaactgttcctgtgctcttcaa
tggctgcagcgctgggaggacaaagggctggccaaactggggtttccatgccaggagccg
gctgccatcatgcccaatgacagctgtggaaagcccctgctgaagattgagctgtccagt
gctacagtgaatgtaggggacaacgtgacactgaattgccagatggagagccagggacgg
agctgggctggctggaacattgaagagctatctgagtttgccactgtggtgcccctggaa
tctgggaatctgtcttccttatggttgattctggtcaatgtctccagcgacctcaacagg
aagaatgtgacatgctgggctgagaatgatgtgggcaggtcggaggaatctgtgcagatc
aacgtctccttcccagctaaggtgcatctccatcaagcaattgcccagcaccactggtgc
atccctttctccgtggacgggcagccaccgcccaccatcacctggcgcttcaacggccac
gtgctcaatgagaccaacttcatcttcacggagttcctggagcaggcagccaacgagacc
atgcagcacggctgcctgcgacttaacaagcccacgcacgtcaacaacggcaattatacc
ctggaagcctccaaccctggtggccgggacgttgcttctcggttttttatcttcatggac
aatcctttccagttcaaacccgaggatcccatccctgtttcttattccccgggagcaacc
aacagcacttctgggcaccccgtggagaagaaggaagactcatattttggggtctcagtg
gcagtgggcttagctgtttttgcctgcctctttctcttggttttactcattcttctcaac
aaatgtggccggagaagcaagttcggaatcaaccgtcctgcggtcctggcccccgaggac
agtctggccatgtccctacatttcatgactctgggaaacagttccctatctcctgaggga
aagggatccggcctgcaggggcacatcatcgagaatccacaatacttcagtgacgcctgt
gtccatcacattaagcgcagagacatcgtgctcaaatgggagctgggagaaggtgccttc
gggaaggtcttcctggccgaatgtcacaacctgcttccagagcaggacaagatgctcgtg
gctgtcaaggctctgaaggaggtgtccgagagtgcccgtcaggacttccagcgggaggca
gagctgctgaccgtcctgcagcaccaacacatagtccgctttttcggggtctgcacagag
ggccgcccactgctcatggtcttcgagtacatgaaacacggagacctgaaccgctttctc
aggtctcatgggccagatgctaagatactggctagcggagtgggtacggctcctggaccc
ctaggcctggggcagctgctggcagtggccggccaggtggcagctgggatggtctacctg
gctagcctgcattttgtgcaccgtgacctggccaccaggaactgcctggtgggtcagggg
cttgtggtcaagattggagactttggtatgagccgagacatctacagcactgactactac
cgggtggggggccgcacgatgctacctatacgatggatgccgccagagagtatcctctat
cggaagttcaccacggaaagtgatgtctggagcttcggcgtccttctctgggagatcttc
acctatggcaaacagccctggtaccagctctccaacactgaggccatcgagtgcattact
cagggcagggaactggagaggccccgggcctgtcccccagaggtctacgccatcatgcgt
ggctgctggcagcgggagccccagcaacgccacagcatcaaggacatccatgcccggctc
caggccctcatcaaggcccctcccgtctacctggacgtcctgggctag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100916994
Entry
100916994         CDS       T02286                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04260  Cardiac muscle contraction
shr04261  Adrenergic signaling in cardiomyocytes
shr05200  Pathways in cancer
shr05216  Thyroid cancer
shr05410  Hypertrophic cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100916994 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    100916994 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100916994 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100916994 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100916994 (TPM3)
   05414 Dilated cardiomyopathy
    100916994 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:shr04812]
    100916994 (TPM3)
Cytoskeleton proteins [BR:shr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100916994 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ TMF_DNA_bd HrpB7 ATG16 ERM MAD CENP-F_leu_zip DUF745 ADIP BORCS7 Laminin_I
Other DBs
NCBI-GeneID: 100916994
NCBI-ProteinID: XP_031822483
Ensembl: ENSSHAG00000012786
LinkDB
Position
4
AA seq 285 aa
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEDRSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESRCREMDEQIRLMDQNLKCLNAAEEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcaaatgctgaaactggacaaggaaaatgccttg
gaccgggcagagcaggctgaggctgaacagaagcaggcagaggaccgaagcaagcagttg
gaggatgagctggctgctatgcagaagaagttgaagggaacggaggatgaactggacaag
tattcagaagcactgaaggatgcccaggagaagctggaactggcagagaagaaggcagca
gatgctgaggctgaggtggcttccttgaaccgtcggatccagttggtagaagaggagctg
gaccgtgctcaggagcgcctggctacagctctgcagaagttagaggaggcagagaaggca
gctgatgagagtgagagaggtatgaaggtcattgaaaatcgggccttgaaggatgaagaa
aagatggagctgcaagaaatccagctgaaagaggctaagcacattgctgaagaagcagac
aggaagtacgaggaggtggcccgaaagttggtaatcattgagggagacttggagcgcaca
gaggagcgggccgagctggcagaatcccgttgccgggagatggatgagcagatcagactg
atggaccagaacctgaagtgtctgaatgctgctgaagaaaagtattctcagaaagaagac
aaatatgaggaggagataaaaattcttaccgataaactcaaggaggcagagactcgtgct
gagtttgctgagagatcagtagccaagctggaaaagacaattgatgacttggaagataaa
ctgaaatgcaccaaagaggagcacctctgcacacaaaggatgctggaccagactctgctt
gacctgaatgagatgtag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100926491
Entry
100926491         CDS       T02286                                 

Gene name
TPR
Definition
(RefSeq) nucleoprotein TPR isoform X1
  KO
K09291  nucleoprotein TPR
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03013  RNA transport
shr05014  Amyotrophic lateral sclerosis
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100926491 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926491 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100926491 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100926491 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:shr03019]
    100926491 (TPR)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100926491 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 AAA_13 TFIIA Ntox1
Other DBs
NCBI-GeneID: 100926491
NCBI-ProteinID: XP_023357598
Ensembl: ENSSHAG00000015305
LinkDB
Position
4
AA seq 2362 aa
MAAVLQQVLERQELTKLPKPVQAKLEKFLADQQSEIDCLKGRHEKFKVESEQQYFEVEKR
LSQSQERLVNESRECQILRQELEKLNQQLKSVTEKNKELETAQDRHVAIQSQLTRAKEEL
EAEKRDLVRTSERRSQELEYLTEDVKRLNEKLKESNTSKGELQLKLDELQASDVSVKYRE
KRLEQEKELLHNQNTWLNTELKTKTDELLAVGREKGNEILELKCNLENKKEEVSRMEEQL
NGLKTSNDHLQKHVEDLLTKLKEAKEQQANMEEKFHNELNAHMKLSNLYKSAADDSEAKS
NELTGAVDELHKLLKEAGETNKGMQDHLMEVEESKAQMEKEMLEKICKLERELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKHSS
VLERDNQRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQETTSSRITELQIQLESALTELEQLRESRHHQ
MQLVDSIVRQRDMYRILLSQTTGVVIPLQASSLEEISLVSTPKHSSGVSQTISTPAPVST
VESTEAIEAKAALKQLQEIFENYKKEKVENDKIQNEQVEKLQEQVTDLRSQNTKISTQLD
FASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEV
RAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLNN
QIEKLEREISQLKKKLENEVEQRHTLTRNQDVHLLDTKRQLETEINRHLNTKELLKNAQK
EAATLKQQLNNVEAQLASQSAQRAPGKGQPNTKEDIDDLISQLRQAEEQINDLKERLKTT
SSNVEQYRAMVLSLEESLNKEKQVTEEVRKNIEARLKDSAEYQAQLEKKLMEAEKEKQEL
QDEKRRALESMEQQLSELKKTLSNVQNEVQEALQRASTALSNEQQARRDCQEQAKIAIEA
QNKYERELMLHAADVEALQAAKEQVSKNLLVRQQLEETAQKAESQLLECKASWEERERML
KDEAAKCVSRCEDLEKQNTLLHDQIEKLSDKVVTSMKEGVQGSLNVSLNEEGKSQEQILE
ILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQ
HEELMKKTETMNVVIETNKMLREEKERLEQELQQMQAKVRKLELDILPLQESNAELSEKS
GMLQAEKKLLEEDIKRWKARNQHLASQQKEPDLEECRKLLSEKEVNTKRIQQLTEETGRL
KAEIARSNASLTTSQNLIQNLREELNKMRTEKETLQKDLEAKVADIQEKVKTITQVKKIG
RRYKTQYEELKAQHDKVMETSQSSGELLEQQVSVHEVQELKETLNQAEIKTKSLENQIEN
LQKTVSEKEAEARSLQEQITQLQSELSRLHQDLQDRTTQEEQLRQHMTEKEDKTRKALVA
AKAKLAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKSQYEGRISRLERELRE
QQERHLEQRDEPQETTSKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPS
KVTAAAIAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVDHVP
VFGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPASQELSPSIVE
VVQSSPIERPSTSTSVFGTVSATPSSSLPKRAREEEDDSTTETSEQVSDETIDMPLSKKL
KSIPPVGPEEEVAAEESTDGEVEPLVNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTSISCQDAQSKGDDVIVIDSDDEDDDDDENDGEQEDYEEDDDEDDDDDDEDT
GMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESTGGEISQRAADSQNGGEG
TSLTESSLPHENSREQQPSSASERQGPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQRI
QMTRRQSVGRGLQLTPGIGGMQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVP
RFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPV
TVFTESTTADASEHASQSVPMVTTSTGSLSTTAETGTGDDGDEVFVETEPEGISSEAGLE
IDSQQEEEPVQASDESDLPSTSQDPPSSSSADTSSSQPKPFRRVRLQPQTLRTGVRGRQF
NRQRGVTHAMGGRGGLNRGNIN
NT seq 7089 nt   +upstreamnt  +downstreamnt
atggcggcggtgctgcagcaggtcctggagcggcaggagctgaccaaactgcccaagccc
gtccaggccaaattggagaagttcctggcggaccagcagagcgaaatcgactgtctgaag
ggacgacacgaaaagttcaaggtggaaagcgaacaacaatactttgaggtagagaagcgg
ctgtcccagtctcaagagagacttgtaaatgaaagccgagaatgccaaatattgcgtcaa
gaactggaaaaacttaatcaacaattgaagtcagtgactgagaaaaacaaagaattggaa
actgcgcaagatcgacatgttgctattcagagtcaacttacaagagcaaaggaggaattg
gaagctgagaaaagagatttggtcagaaccagtgaaagacgttcacaagaacttgaatat
ttaactgaggatgttaagcgcctaaatgaaaaactcaaggaaagcaatacctcaaaagga
gagctacagttaaaattagatgaacttcaagcatctgatgtttctgttaagtatcgagag
aaacgtttggaacaagaaaaggaattattacataatcagaacacatggctgaatacagag
ctaaaaaccaaaactgatgaacttctggctgttggtagagaaaaaggaaatgaaatcctg
gaacttaaatgtaatcttgaaaacaaaaaagaagaggtttccagaatggaggaacaattg
aatggcttgaaaacatcaaatgaccatctacaaaaacatgttgaagaccttctgaccaaa
ttgaaagaggccaaggagcagcaggccaatatggaagaaaaatttcacaatgagttaaat
gctcacatgaaactctctaatttgtataagagtgctgctgatgattctgaagcaaaaagc
aatgagctaactggagcagtggatgagcttcacaagcttttaaaagaagctggagaaact
aacaagggaatgcaagaccatttaatggaagtggaagaatcaaaagcccaaatggaaaaa
gaaatgctagagaaaatttgcaaattagagagagaactagagaatgctaatgatctactt
tcagccacaaaacggaaaggggccatattatctgaagaggaacttgcagctatgtctcct
actgcagcagctgtagctaaaatagtgaaacctggaatgaaattaactgagctatacaat
gcatatgtagaaacacaagatcaactgctcctagagaagctggagaataagagaattaat
aaatatctagatgaaatagtaaaagaagttgaagcaaaagcaccaattctaaaacgccaa
cgtgaggaatatgaacgtgcccaaaaggctgtggcaagtttatctgttaagcttgagcaa
gcaatgaaggaaatacagcgattgcaagaggacactgataaagccaacaaacattcatct
gtacttgaaagggacaaccaaagaatggaaatacaagtgaaagatctatcacaacagatt
agagttcttttgatggaacttgaagaggcaaggggtaatcatgtaattcgtgatgaagaa
gtaagttctgctgacatcagtagttcatctgaagttatatcacagcatctagtctcctac
agaaatattgaagaacttcagcaacagaatcagcgccttttagtagcccttagggagctt
ggggagacaagagaaagagaagaacaagaaacaacttcttcaagaattactgaacttcaa
attcagcttgagagtgccctcactgaattggaacaacttcgtgaatcccgacaccatcag
atgcaacttgttgattcaatagtccgtcagcgtgacatgtatcgtattttgttgtcgcag
acaaccggagttgttattccattgcaagcttcaagcttagaggagatttccctagtgtcc
acaccaaagcattcttcaggtgtgtcacagaccatctccactcctgctccagtttccaca
gttgagtcaacagaggcaatagaggccaaggctgcactcaagcagttgcaggaaattttt
gaaaactacaaaaaagaaaaggtagaaaatgataaaattcaaaatgaacaagttgagaaa
cttcaggagcaagttacagatttacggtcacagaataccaagatttctactcaactagat
tttgcttctaaacgctatgaaatgctacaagataatgtcgagggatatcgtcgagaaatt
acatctttacatgagagaaaccaaaaactcactgcaacaactcaaaagcaggagcagatc
atcaatacaatgactcaagatctaagaggagcaaatgagaagttggcagttgcagaagta
agagcagaaaatttgaaaaaggaaaaggaaatgttgaaattgtcagaagttcgtctctcg
caacagagagaatctttgttagctgaacaaagaggacaaaacttattactaactaacctg
caaacaattcagggaatactggagagatctgaaacagaaactaagcagagacttaataac
cagatagaaaagcttgaacgtgaaatatctcagctaaagaagaaattagaaaatgaagta
gaacaaagacacacacttacaagaaatcaggatgttcatcttttagatacaaagagacag
ctagagactgaaataaaccgtcaccttaatacaaaagaattactaaaaaatgctcaaaag
gaagctgctacattgaaacaacaactcaataatgttgaagcccagcttgcttcccagtca
gcacagagagctcctggaaaaggtcagcctaatactaaagaagacatagatgatctgatc
agtcaactaaggcaagctgaagagcagattaatgatctgaaagaaagactcaagacaaca
tctagtaatgtagaacagtatcgagctatggttcttagcttagaagaatccctaaacaag
gaaaaacaagtgacagaagaggtacgtaaaaatattgaagcccgtttaaaagactcagct
gagtatcaggcacaactggaaaaaaaattaatggaagcagagaaggaaaaacaagaactt
caggatgaaaagcgcagagctcttgaaagtatggagcagcagctatctgaattaaagaag
actctctctaatgttcaaaatgaagttcaagaagctcttcagagagcaagcacagctttg
agtaatgagcagcaagccagacgtgattgtcaggagcaggctaaaatagcaatagaggct
cagaataaatatgaacgggaactgatgctacatgctgctgatgtggaagctttgcaggct
gctaaagaacaagtctctaaaaatttactagtgcgtcagcagttggaagaaacggctcag
aaagcagaatcacagttgttggaatgcaaagcctcttgggaggaaagagagagaatgtta
aaggatgaagctgccaagtgtgtgtctcgctgtgaagacttagagaaacaaaatacatta
cttcatgatcagattgaaaaattaagtgacaaggttgtgacttctatgaaagaaggtgtg
caagggtcattaaatgtttctctaaatgaagaaggcaagtctcaagaacaaatcttagaa
attctcaggtttatacggcgagaaaaagaaattgcagaaaccaggtttgaagtagcccag
gtagaaagtttgcgttacagacaacgggtagagctcctagagagagagcttcaggagctg
caggatagtctaaatgctgagagggagaaagtccaggtaactgcaaaaacaatggctcag
catgaagaactgatgaaaaaaactgaaacaatgaatgtagttatagaaaccaacaaaatg
ctgagggaagaaaaagaaaggctggaacaagaactacaacagatgcaagcaaaggtcagg
aaactggaattagatatcttgccattacaagaatcaaatgctgaactgagtgagaaaagt
ggtatgttgcaagcagaaaagaagttgctagaagaagatatcaaacgctggaaagcacga
aaccagcatcttgcaagccagcaaaaagagccagatttggaagaatgtcgaaagctcctt
tcagagaaggaagtaaatactaaacgcattcaacagttgactgaagaaactggaagactt
aaagcagaaattgcaaggtcaaatgcatctttgaccactagccaaaatttaattcagaac
ctaagggaagaattaaataaaatgagaactgaaaaggaaactctccagaaggacttagaa
gccaaagtagctgatatacaagaaaaagtcaaaactattactcaagtcaagaaaattgga
agaagatataagactcaatatgaagagcttaaagcacaacatgataaggtaatggagact
tctcagtcttctggagaactactggaacaacaagtatctgtccatgaagtgcaagagctc
aaagaaactctgaatcaagctgaaataaaaacgaaatctctagaaaaccaaatcgagaac
cttcagaagacagtatctgaaaaagaggctgaagctagaagtcttcaggagcagataacg
caacttcagtctgaactgtcacgtcttcatcaagatctccaagacagaactacacaggag
gagcagctgcgacaacatatgacggaaaaagaagacaaaaccagaaaggctcttgttgca
gccaaagcaaagctggcacatttagctggtgtcaaagatcagctaactaaagaaaacgaa
gagcttaaacaaagaaatggtgcattagatcaacagaaggatgagctggatgtccgtatg
actgctcttaaatcacagtatgaaggtcgaattagccgcttggaacgagaactcagggaa
cagcaagaaagacatcttgagcaaagagatgagcctcaggaaactactagcaaggtccct
gaacaacaaagacagatcaccctcaaaacaactccagcttcaggtgaaagaggaattgct
agtacatcagatccaccaacagccaatatcaagccaactcctgttgtatctactccaagc
aaagtgacagctgctgccatagctgggaataaatcaacaccaagagctagtatccgacct
atggttacacctgcaacagttacaaatccaaccactactccaacagctacagtgatgccc
acaacacaggtggaatctcaggaagctatgcagtcagaaggacctgtggatcatgttcca
gtttttggaagcacaagtgggtctgttcgttctaccagtcccaacgtccaaccctctatt
tcccaacctattttaactgttcagcaacaaacacaggctacagcctttgtgcagcccact
cagcaaagtcatcctcaaattgagcctgctagccaagaactttcccccagcattgtagaa
gttgtacaaagttcaccaattgaaagaccttccacttcaacatcagtgtttggtacagtt
tcagctactccaagttcatctttgcctaaacgtgcacgtgaagaagaagatgatagcacc
acagagacatcagaacaagtctctgatgaaacaatagatatgcctctctcaaagaaattg
aagagcataccccctgtaggacctgaggaagaagttgcagcagaagagagcactgatgga
gaggtcgagccccttgtaaatcaggattcacaagattctattggagaaggagtcactcag
ggagattatacacctatggaagacagtgaagaaacttctcaatcccttcaaatagatctt
ggacccctacagtcagatcaacagacttcaatctcttgccaggatgctcagtccaaagga
gatgatgtcattgtgatagacagtgatgatgaagacgatgatgatgatgaaaatgatggt
gaacaagaggactatgaggaggatgatgatgaagatgatgacgacgatgatgaagataca
ggaatgggagatgaaggtgaagatagtaatgaaggcactggtagtgcagatggcaatgat
ggctatgaagctgatgatgctgagggtggtgatggtactgatccaggtactgaaacagaa
gaaagtacaggaggtgaaattagccagagagctgcagattctcaaaatggtggtgaagga
acttctcttacagaatcatctttgccccatgagaattctagagaacaacaaccatcatca
gcatctgaaagacagggtcctcgggcacctcagtcacctcgaagaccacctcatccactt
cccccacgactaactatccatgcacctcctcaggagttgggaccaccagtccagagaatt
caaatgacacgaagacagtcagttggacgaggacttcagctaactcctggcataggtggc
atgcagcacttttttgatgatgaggaccgaactgtgccaagtacaccaactcttgtggta
ccacatcgtacagatggatttgcagaagcaattcattcgccccaggttgctggtgttccc
agattccgatttggaccccctgaagacatgccacaaacaagttctagccattcagatctt
ggtcagcttgcatctcaaggaggtttaggtatgtatgaaacacccctcttcttagcacat
gaagaagaatctggtggccgaagtgttcctactactcctctacaagttgcagctccagtg
actgtatttactgaaagtactactgctgatgcttctgagcatgcatctcagtctgttcca
atggtgacaacatccaccggcagtttgtccacgactgcagaaactgggacaggtgatgat
ggagatgaagtatttgtggagacagaacctgaaggaattagttcagaagctggcctagaa
attgatagccagcaggaggaagaacctgttcaggcatctgatgagtctgatcttccttct
actagccaagatcctccgtccagttcctctgcagatactagcagtagtcaacctaagcct
ttcagacgagttaggcttcagcctcagactttaagaacaggagtccggggtcgtcagttt
aaccgacaaagaggtgtgacccatgcaatgggaggcagaggaggactaaacagaggaaat
attaattaa

DBGET integrated database retrieval system